KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658139
Entry
104658139         CDS       T03989                                 

Gene name
GRM4
Definition
(RefSeq) metabotropic glutamate receptor 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04072  Phospholipase D signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04724  Glutamatergic synapse
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    104658139 (GRM4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104658139 (GRM4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    104658139 (GRM4)
  09157 Sensory system
   04742 Taste transduction
    104658139 (GRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104658139 (GRM4)
G protein-coupled receptors [BR:rro04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   104658139 (GRM4)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Haem_degrading
Other DBs
NCBI-GeneID: 104658139
NCBI-ProteinID: XP_030785309
LinkDB
Position
4
AA seq 912 aa
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGRQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWDSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgcctgggaagagaggcttgggctggtggtgggcccggctgcccctttgcctgctcctc
agcctttacggtccctggatgccttcctccctggggaagcccaaaggccaccctcacatg
aattccatccgcatagatggggacatcacactgggaggcctgttcccggtgcatggccgg
ggctcagagggcaaggcctgtggagaacttaagaaggaaaagggcatccaccgactggag
gccatgctcttcgccctggatcgcattaacaacgacccggacctgctgcccaacatcacg
ctgggcgcccgcattctggacacctgctccagggacacccatgccctcgagcagtcactg
acctttgtgcaggcgctcatcgagaaggatggcacggaggtccgctgtggcagtggcggc
ccacccatcatcaccaagcctgaacgcgtggtgggtgtcatcggtgcttcagggagctcg
gtctccatcatggtggccaacatccttcgcctcttcaagataccccagatcagctacgcc
tccaccgcgccagacctgagcgacaacagccgctacgacttcttctcccgcgtggtaccc
tcggacacgtaccaggcccaggccatggtggacatcgtccgtgccctcaagtggaactac
gtgtccacggtggcctcggagggcagctatggcgagagcggtgtggaggccttcatccag
aagtcccgtgaggatgggggcgtgtgcatcgcccagtcggtgaagataccacgggagccc
aaggcaggcgagttcgacaagatcatccgccgcctcctggagacttcaaacgccagggca
gtcatcatcttcgccaatgaggatgacatcaggcgtgtgctggaggcagcacgaagggcc
aaccagacaggccatttcttctggatgggctctgacagctggggctccaagattgcacct
gtactgcacctggaggaggtggctgagggcgctgtcacgatcctccccaagaggatgtct
gtacgaggcttcgaccgctacttctccagccgcacgctggacaacaaccggcgcaacatc
tggtttgccgagttctgggaggacaatttccactgcaagctgagccgccacgccctcaag
aagggcagccacgtcaagaagtgcaccaaccgtgagcgaattgggcaggattcagcttat
gagcaggaggggaaggtgcagtttgtgattgacgccgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtggggctctgcccacgcatggacccc
gtagatggcacccagctgcttaagtacatccgaaacgtcaacttctcaggcatcgcaggg
aaccctgtgaccttcaatgagaatggagatgcacctgggcgctatgacatctaccaatac
cagctgcgcaatgactctgccgagtacaaggtcatcggctcctggactgaccacctgcac
cttagaatagagcggatgcactggccggggagcgggcggcagctgccccgctccatctgc
agcctgccctgccagccaggtgagcggaagaagacagtgaagggcatgccttgctgctgg
cactgcgagccttgcacagggtaccagtaccaggtggaccgctacacctgtaagacatgt
ccctacgacatgcggcccacggagaaccgcacgggctgccggcccatccccatcatcaag
cttgagtgggactcaccctgggcagtgctgcccctcttcctggccgtggtgggcatcgct
gccacgttgtttgtggtgatcacctttgtacgctacaatgacacgcccatcgtcaaggcc
tcaggccgtgaactgagctacgtgctgctggcgggcatcttcctgtgctacgccaccacc
ttcctcatgatcgccgagcccgacctcggcacctgctcgctgcgccgaatcttcctggga
ctagggatgagcatcagctacgcggccctgctcaccaagaccaaccgcatctaccgcatc
ttcgagcagggcaagcgctcagtcagtgccccacgcttcatcagccccgcctcgcagctg
gccatcaccttcagcctcatctcgctgcagctgctgggcatctgtgtgtggtttgtggtg
gacccctcccactcagtggtggacttccaggaccagcggacgctggacccccgcttcgcc
aggggtgtgctcaagtgcgacatctcagacctgtcgctcatctgccttctgggctacagc
atgctgctcatggtcacatgcaccgtgtatgccatcaagacacgcggcgtgcccgagacc
ttcaacgaggccaagcccattggcttcaccatgtacaccacctgcatcgtctggctggct
ttcatccccatcttctttggcacctcgcagtcggccgacaagctgtacatccagacgacg
acgctgaccgtctcggtgagtctgagcgcctcggtatccctgggaatgctctacatgccc
aaggtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagcctc
aaagccgtggtcacggcggccaccatgtccaacaagttcacgcagaagggcaacttccgg
cccaacggcgaggccaagtctgagctctgcgagaacctcgaggccccagcgctggccacc
aaacagacttacgtcacttacaccaaccatgcaatctag

DBGET integrated database retrieval system