KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658243
Entry
104658243         CDS       T03989                                 

Gene name
SCNN1G
Definition
(RefSeq) amiloride-sensitive sodium channel subunit gamma isoform X1
  KO
K04827  amiloride-sensitive sodium channel subunit gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104658243 (SCNN1G)
  09157 Sensory system
   04742 Taste transduction
    104658243 (SCNN1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104658243 (SCNN1G)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   104658243 (SCNN1G)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 104658243
NCBI-ProteinID: XP_010356511
LinkDB
Position
20
AA seq 690 aa
MLARERADEQRTRIAHSRALDPLEPRARPSSKSCPQSRILAMAPGEKIKAKIKKNLPVTG
PQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFY
TVSVSIKVHFRKLDFPAVTICNINPYKYSAVRHLLADLEQETREALKSLYGFPESRKRRD
AESWSSVLEGMQPRFSHRIPLLIFDQYEKGKARDFFTGRKRKVDGRIIHKASNVMHIESK
QVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEELLVT
CFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNP
FLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDV
PIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYGQPLPPEANYCNYQQHPNWMYCYYQLH
RAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWLLPVLTWDQGRQINKKLNKT
DLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFIDFFS
IIARRQWQKAKEWWARKQAPPCPEAPHSPQGQDNPALDIDNDLPTFNSALHLPPALGTQV
PGTPPPKYNTLRLERAFSNQLTDTQMLDEL
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgctagcccgagagcgagcagatgagcagcgcacccggatcgctcattcacgagccttg
gaccctttggaaccgagagcacgcccgtcctcaaagtcctgtcctcaaagtcgcatcctc
gccatggctcctggagagaagatcaaagccaagatcaagaagaatctgcccgtgacgggc
cctcaggcgccgaccattaaagagctgatgcggtggtactgcctcaacaccaacacccat
ggctgccgccgcatcgtggtgtcccgcggccgcctgcgccgcctcctctggatcgggttc
acactgactgcagtcgccctcatcctctggcagtgcgccctcctcgtcttctccttctat
actgtctccgtttccatcaaagttcacttccggaagctggattttcctgcggtcaccatc
tgcaatatcaacccctacaagtacagcgctgtgcgccaccttctagctgacttggaacag
gagaccagagaggccctgaagtccctgtatggctttccagagtcccggaagcgccgagac
gcagagtcctggagctccgtcttggagggaatgcagcccagattctcccaccggatcccg
ctgctgatctttgatcagtatgagaagggcaaggccagggacttcttcacagggaggaag
cgaaaagttgatgggagaatcattcacaaggcttcaaatgtcatgcacatcgagtccaag
caggtggtgggattccaactgtgctcgaatgacacctccgactgtgccacctacaccttc
agctcggggatcaatgccattcaggagtggtataagctgcactacatgaatatcatggca
caggtgcctctggagaagaaaatcaacatgagctattctgctgaggagctgctggtgacc
tgcttctttgatggagtgtcctgtgatgccaggaatttcacgcttttccaccatccaatg
catgggaattgctacactttcaacaacagagaaaatgagaccattctcagcacctccatg
gggggcagcgaatatgggctgcaagtcattttgtacataaatgaagaggaatacaaccca
ttcctcgtttcctccactggagctaaggtgatcatccatcggcaggacgagtatcccttc
gtcgaagatgtgggaacagagattgagacggcaatggtcacctctataggaatgcacctg
acagagtccttcaagctgagtgagccctacagtcagtgcacggaggacgggagtgacgtg
ccaatcaggaacatctacaacgctgcctactcgctccagatctgccttcattcatgcttc
cagacaaagatggtggagaaatgtgggtgtgcccagtacggccagcctctacctcccgaa
gccaactactgcaactaccagcaacaccccaactggatgtattgttactaccaactgcat
cgagcctttgtccaggaagagctgggctgccagtctgtgtgcaaggaagcctgcagcttt
aaggagtggacactaactacgagcctggcacaatggccatctgtggtttcggagaagtgg
ttgctgcctgttctcacttgggaccaaggccggcaaataaacaaaaagctcaacaagaca
gacttggcaaaactcttgatattctacaaagacctgaaccagagatccatcatggagagc
ccagccaacagtattgagatgcttctgtccaacttcggtggccaactgggcctgtggatg
agctgctctgttgtctgcgtcattgagatcattgaggtcttcttcatcgacttcttctct
atcattgcccgccgccagtggcagaaagccaaggagtggtgggctcggaagcaggctccc
ccctgtccagaagctccccacagcccacagggccaggacaacccagccctggatatagac
aatgacctacccactttcaactctgctttgcacctgcctccagccctaggaacccaagtg
cccggcacaccgccccccaaatacaataccttgcgcttggagagggccttttccaaccag
cttacagatacccagatgctagatgagctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658244
Entry
104658244         CDS       T03989                                 

Gene name
SCNN1B
Definition
(RefSeq) amiloride-sensitive sodium channel subunit beta isoform X2
  KO
K04825  amiloride-sensitive sodium channel subunit beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104658244 (SCNN1B)
  09157 Sensory system
   04742 Taste transduction
    104658244 (SCNN1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104658244 (SCNN1B)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   104658244 (SCNN1B)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 104658244
NCBI-ProteinID: XP_010356513
LinkDB
Position
20
AA seq 654 aa
MLWPRPLLGKEGATMHVKKYLLKCLHRLQKGPGYTYKELLVWYCNNTNTHGPKRIICEGP
KKKAMWFLLTLLFTALVCWQWGNFIRTYLSWEVSISLSVGFKTMDFPAVTICNASPFKYS
KVKHLLKDLDELMEAVLERILAPELSHANATRTLNSSIWNHTPLVLIDERNPHHPVILDL
FGDNHNGLTNSSASEKICNAHGCKMAMRLCSLNGTQCTFRNFTSATQAVTEWYSLQATNI
FAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPS
ANPGTEFGLKLILDIGQEDYVPFLTSTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGV
LVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIHSCKCGHYLY
PLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEA
SEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNLVWLLSNLGGQF
GFWMGGSVLCLIEFGEIIIDFVWITIINLVALAKSLRQRRAQASYSGPPPTVAELVEAHT
NFGFQPDTAPRSPNTGPYPNEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgctttggccaagaccccttttggggaaggaaggtgccaccatgcacgtgaagaagtac
ctgctgaagtgcctgcaccggctacagaagggccctggctacacgtacaaggagctgctg
gtgtggtactgcaataacaccaacacccatggccccaagcgtatcatctgcgaggggccc
aagaagaaagccatgtggttcctgctcaccctgctcttcactgctctcgtctgctggcag
tggggcaacttcatcaggacctacttgagctgggaggtcagcatctccctctccgtaggc
ttcaagaccatggacttccccgccgtcaccatctgcaatgctagccccttcaagtattcc
aaagtcaagcatttgctgaaggacctggatgagctgatggaagctgtcctggagagaatc
ctggctcctgagctaagccatgccaatgccaccaggaccctgaactcctccatctggaac
cacacacccctggtccttattgatgaacggaacccccaccaccctgtgatcctcgatctc
tttggagataaccacaatggcttaacaaacagctcagcatcagaaaagatctgtaatgcc
catgggtgcaaaatggccatgagactatgtagcctcaatgggacccagtgcaccttccgg
aacttcaccagcgctacccaggcagtgacagagtggtacagcctgcaggccaccaacatc
tttgcacaggtgccacagcaggagctggtggagatgagctaccctggcgagcagatgatc
ctggcctgcctgtttggagctgagccctgcaactaccggaatttcacgtccatcttctac
cctcactatggcaactgttacatcttcaactggggcatgacagagaaggcacttccttcg
gccaaccctggaactgaattcggcctgaagttgatcctggacataggccaggaagactac
gtccccttcctcacatccacggccggggtcaggctgatgcttcacgagcagaggtcatac
cccttcatcagagatgagggcatctatgccatgtcggggacagagacatccatcggggta
ctcgtggacaagcttcagcgcatgggggagccctacagcccatgcaccgtgaatggctcc
gaggtccccgtccaaaacttctacagtgactacaacacgacctactccatccaggcctgt
cttcgctcctgcttccaagaccacatgatccatagctgcaagtgtgggcactacctctac
ccactgccccgtggggagaaatactgcaacaaccgggacttcccggactgggcccattgc
tactcagatctgcagatgagcgtggcgcagagagagacctgcattggcatgtgcaaggag
tcctgcaatgacacccagtacaagatgactatctccatggctgactggccttctgaggcc
tctgaggactggattttccacgtcttgtctcaggagcgggaccaaagcaccaatatcacc
ctgagcaggaagggaattgtcaagctcaacatctacttccaagaatttaactatcgcacc
attgaagaatcagcagccaataacctcgtctggctgctctcgaatctgggtggccagttt
ggcttctggatggggggctctgtgctgtgcctcatcgagtttggggagatcatcatcgac
tttgtgtggatcaccatcatcaatctggtggccttggccaagagcctacggcaacggcga
gcccaagccagctactctggcccaccgcccacggttgctgagctggtggaggcccacacc
aactttggcttccagcctgacacggccccccgcagccccaacaccgggccctaccccaat
gagcaggccctgcccatcccgggcaccccgccccccaactacgactccctgcgtctgcag
ccactggacgtcatcgagtctgacagtgaaggtgatgccatctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680125
Entry
104680125         CDS       T03989                                 

Gene name
SCNN1A
Definition
(RefSeq) amiloride-sensitive sodium channel subunit alpha isoform X2
  KO
K04824  amiloride-sensitive sodium channel subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104680125 (SCNN1A)
  09157 Sensory system
   04742 Taste transduction
    104680125 (SCNN1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104680125 (SCNN1A)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   104680125 (SCNN1A)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 104680125
NCBI-ProteinID: XP_010384263
UniProt: A0A2K6RRL5
LinkDB
Position
10
AA seq 663 aa
MEGTKLEEQDASPPQPTPGLTKGDKHEEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFE
FFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINL
NSDKLVFPAVTICTLNPYRYPEIKEELEELDRITQQTLFDLYKYDSSPTLVAGSRGRRDL
RSTLPHPLQRLRVPRQARSAASSVRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVD
AVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCY
TFNDKNNSNLWMSSMPGVNNGLSLMLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGG
FNLRPGVETSISMRKEALDRLGGDYGDCTKNGSDVPVKNLYPSKYTQQVCIHSCFQENMI
KECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQADFSSDHLGCFTKCRKPCSVTSYQL
SAGYSRWPSVTSQEWVFEMLSRQNNYTINNKRNGVAKVNIFFKELNYKTNSESPSVTMVT
LLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITFLMLLRRFRSRYWSPGRGDRGAQEVA
STQASSPPSHFCPHPTPLYLSQLGPAPSPALTAPPPAYATLGPCPSPGGSAGASSSAYPL
GGP
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggaggggaccaagctggaggagcaggacgctagccctccacagcccaccccagggctc
acgaagggggacaagcatgaggagcaggggctgggcccagaacctgcggcaccccagcag
cccacggcggaggaggaggccctgatcgagttccaccgctcctaccgagagctcttcgag
ttcttctgcaacaataccaccatccacggtgccatccgcctggtgtgctcccagcacaac
cgcatgaagacggccttctgggcagtgctctggctctgcacctttggcatgatgtactgg
caattcggcctgcttttcggagagtacttcagctaccccgtcagcctcaacatcaacctc
aactcggacaagcttgtcttccccgcagtgaccatctgcaccctcaatccctacaggtat
ccggaaattaaagaggagctggaggagctggaccgcatcacacagcagacgctctttgac
ttgtacaaatacgactcctcccccaccctcgtggccggctcccgcggccgtcgcgacctg
cggagcactctgccgcaccccttgcagcgcctgagggtcccccgtcaagcccgtagcgcg
gcctccagcgtgcgggacaacaacccccaagtggactggaaggattggaagatcggtttc
cagctgtgcaaccagaacaaatcagactgcttctaccagacatactcatcaggagtggat
gcagtgagggagtggtaccgcttccactacatcaacatcctgtcgaggctgccggagact
ctgccatccctggaggaggacacactgggcaacttcatcttcgcctgccgcttcaaccag
gtctcctgcaaccaggcgaattactctcacttccaccacccgatgtatggaaactgctat
actttcaatgacaagaacaactctaacctctggatgtcttccatgcctggagtcaacaat
ggtctgtccctgatgctgcgcacagagcagaatgacttcattcccctgctgtccacagtg
actggggcccgggtaatggtgcacgggcaggatgaacctgcctttatggatgatggtggc
tttaacttgcggcctggcgtggagacctccatcagcatgaggaaggaagccctggacaga
cttgggggcgactatggcgactgcaccaagaatggcagtgatgtccctgtcaagaacctt
tacccttcaaagtacacgcagcaggtgtgtattcactcctgcttccaggagaacatgatc
aaggagtgtggctgtgcctatatcttctatccacggccccagaacgtggagtactgtgac
tacaggaagcacagttcctggggctactgctactataagctccaggctgacttctcctca
gaccacctgggctgtttcaccaagtgccggaagccatgcagtgtgaccagctaccagctc
tcggctggttactcacgatggccctcggtgacatcccaggaatgggtcttcgagatgcta
tcgcgacagaacaactacaccatcaacaacaagagaaatggagtggccaaagtcaacatc
ttcttcaaggagctgaactacaaaaccaattctgagtctccctctgtcacgatggtcacc
ctcctgtccaacctgggcagccagtggagcctgtggttcggctcctcagtgctgtctgtg
gtggagatggccgaactcatctttgacctgctggtcatcacgttccttatgctgctccga
aggttccgaagccgatactggtctccaggccgaggggacaggggtgctcaggaggtggcc
tccacccaggcatcctccccgccttcccacttctgcccccaccccacacctctgtacttg
tcccagctaggccctgctccgtccccagccttgacagcccctccccctgcctatgccacc
ctgggcccctgcccatctccagggggctccgcaggggccagctcctccgcctatcctctg
ggggggccctga

DBGET integrated database retrieval system