KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658457
Entry
104658457         CDS       T03989                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro01522  Endocrine resistance
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04727  GABAergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro04976  Bile secretion
rro05032  Morphine addiction
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104658457 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104658457 (ADCY3)
   04371 Apelin signaling pathway
    104658457 (ADCY3)
   04020 Calcium signaling pathway
    104658457 (ADCY3)
   04072 Phospholipase D signaling pathway
    104658457 (ADCY3)
   04024 cAMP signaling pathway
    104658457 (ADCY3)
   04022 cGMP-PKG signaling pathway
    104658457 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104658457 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104658457 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104658457 (ADCY3)
   04062 Chemokine signaling pathway
    104658457 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    104658457 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    104658457 (ADCY3)
   04912 GnRH signaling pathway
    104658457 (ADCY3)
   04913 Ovarian steroidogenesis
    104658457 (ADCY3)
   04915 Estrogen signaling pathway
    104658457 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    104658457 (ADCY3)
   04921 Oxytocin signaling pathway
    104658457 (ADCY3)
   04926 Relaxin signaling pathway
    104658457 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    104658457 (ADCY3)
   04918 Thyroid hormone synthesis
    104658457 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    104658457 (ADCY3)
   04916 Melanogenesis
    104658457 (ADCY3)
   04925 Aldosterone synthesis and secretion
    104658457 (ADCY3)
   04927 Cortisol synthesis and secretion
    104658457 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104658457 (ADCY3)
   04270 Vascular smooth muscle contraction
    104658457 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    104658457 (ADCY3)
   04971 Gastric acid secretion
    104658457 (ADCY3)
   04972 Pancreatic secretion
    104658457 (ADCY3)
   04976 Bile secretion
    104658457 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104658457 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104658457 (ADCY3)
   04727 GABAergic synapse
    104658457 (ADCY3)
   04725 Cholinergic synapse
    104658457 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    104658457 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    104658457 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    104658457 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    104658457 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    104658457 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104658457 (ADCY3)
   04714 Thermogenesis
    104658457 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658457 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    104658457 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104658457 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104658457 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104658457 (ADCY3)
   05163 Human cytomegalovirus infection
    104658457 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104658457 (ADCY3)
Enzymes [BR:rro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104658457 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 104658457
NCBI-ProteinID: XP_010356803
UniProt: A0A2K6RIQ3
LinkDB
Position
17
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYLLWLLITAQIFSYLGLNFTRAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGETLLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPVFDEYDHRRFREHDSLPMVTLEKMQGFTPGLNGTDGLPLVPSK
YSMMVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGPSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgctgccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacctgctgtggctgctcataactgcccagatcttctcttacctgggcctgaacttcacg
cgtgcccacgcggccagtgacaccgtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgataatctccgtggtctcctgtgtggtg
cacaccttggtcttgggggtcactgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
cttcggattaagatcctgggtgactgctactactgcatctgcggcctgcctgactaccgt
gaggaccacgccgtctgctccatcctcatggggcttgccatggtggaagccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcgactgacgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgttcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggaaccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacgtcggagaaacccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccgcgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctcc
gaagacgagcacgagctcaaccagctgctcaacgaggccctgctcgagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgt
gtcgtcctgctctgcacggctctggttgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtgggggagacgctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggacccagcaacgcgacagcaggg
atggagacagagggtggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcgcgggcgccgtggccgccatcaacctctacgcctggcgccccgtcttcgat
gaatacgaccacaggcgttttcgggagcatgacagcttacctatggtgaccttagagaag
atgcagggattcactcctgggctcaacggcactgacgggctgcccctggtgccttccaag
tactccatgatggtgatggtgttcctcatgatgctgagcttctactacttctcccgccac
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggcggtattgagtgtctgcgtttcctcaatgaaatcatctcagatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccctgatgtcaacaccaatggctttgccagctcc
aacaaggaggacaagtctgagagagaacgctggcagcacctggctgacctggccgacttt
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacggtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacatccaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcggggccccatctttgtgaaggggaagggggagctgctgaccttcttcttg
aaggggcgggacaagccagccaccttccccaacggcccctctgtcacactgccccaccag
gtggtagacaactcctga

DBGET integrated database retrieval system