KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658606
Entry
104658606         CDS       T03989                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658606 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658606 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104658606 (TSLP)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104658606 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 104658606
NCBI-ProteinID: XP_010356980
LinkDB
Position
3
AA seq 105 aa
MSETKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPGCASLAKEMFAMKTKATLALWCPGYS
ETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagtgagaccaaaagtaccgacttcaacaacactgtctcctgtagcaatcggccacac
tgccttactgaaatccagagcctaaccttcaatcccacccccggctgcgcgtcgctagcc
aaggaaatgttcgccatgaaaactaaggctaccctcgctctctggtgcccaggctattcg
gaaactcagataaatgctactcaggcaatgaagaagaggagaaaaaggaaagtcacaacc
aataaatgtctggaacaagtgtcacaattactaggattgtggcgtcgcttcattcgaact
ttactgaaaaaacagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658677
Entry
104658677         CDS       T03989                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658677 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104658677 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104658677 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    104658677 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104658677 (IL22)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104658677 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 104658677
NCBI-ProteinID: XP_010357062
UniProt: A0A2K6PCP6
LinkDB
Position
10
AA seq 179 aa
MAALQKSVSSFLMGTLATSCLLLLALSVQGGAAVPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFRGISTSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVP
FLARLSNSLSTCHIEGDDLHIQRNVQNLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagccctgcagaaatctgtgagctctttccttatggggactctggccaccagctgc
ctccttctcttggccctctcggtgcagggaggagcagctgtacccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggaaaagctgttc
cgcggaatcagtacgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgctccctcaatctgataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacagtctaagcacatgtcacattgaaggtgatgacctgcat
atccagaggaatgtgcaaaacctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659483
Entry
104659483         CDS       T03989                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
rro04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659483 (LIF)
   04668 TNF signaling pathway
    104659483 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659483 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104659483 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659483 (LIF)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104659483 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 104659483
NCBI-ProteinID: XP_010357851
UniProt: A0A2K6N7J8
LinkDB
Position
13
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVDLYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKETIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggaaacatggg
gcagggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctgtgtggccccaacgtgacggacttcccacccttccacgccaacggcacggagaaggcc
aagctggtggatctgtaccgcatagtcgtgtacctcggcacctccctaggcaacatcacc
cgggaccagaagatcctcaaccccagtgccctcagcctccatagcaagctcaacgccact
gctgacatcctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtgggccatgtggacgtgacctatggccctgacacctcgggtaaggacgtcttccagaag
aagaagctgggctgtcaactcctggggaagtataaggagaccatcgccgtgttggcccag
gccttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659494
Entry
104659494         CDS       T03989                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M isoform X1
  KO
K05418  oncostatin M
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659494 (OSM)
   04151 PI3K-Akt signaling pathway
    104659494 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659494 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659494 (OSM)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104659494 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 104659494
NCBI-ProteinID: XP_010357860
UniProt: A0A2K6QJG6
LinkDB
Position
13
AA seq 252 aa
MGVPLTRRTLLSLVLALLFPSMASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQHLPKA
QDLERSGLNIEDLEKLQMARPNVLGLRNNIYCMAQLLDNSDMTEPTKAGRGASQPPTPTP
TSDVFQRKLEGCRFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GNRLMPRGQLPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggggtaccgctcacacggaggacgctactcagtctggtccttgcactcctgtttcca
agcatggcaagcatggcggctatgggcagctgctcgaaagagtaccgcatgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcaggctcctggacccctatata
cgtatccaaggcctggatattcctaaactgagagagcactgcagggagagccctggggcc
ttccccagtgaggagaccctaagggggctgggcaggcggggcttcctacagacgctcaat
gccacactgggctgcgttctgcacagactggccgacttagagcagcatctccccaaggcc
caggacttggagaggtctgggctgaacatagaggacttggagaagctgcagatggcgagg
ccgaatgtcctcgggctcaggaacaacatctattgcatggcccagctgctggacaactca
gacatgactgagcccacaaaggccggccggggggcctctcagccgcccacccccacccct
acctcggatgtttttcagcgaaagctggagggctgcaggttcctgcgtggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccgg
agacacagtccccaccaggccctgcggaagggggtgcgcaggacgagaccctccaggaaa
ggcaatagactcatgcccaggggacagctgccccggtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659785
Entry
104659785         CDS       T03989                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro05310  Asthma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659785 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659785 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    104659785 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659785 (IL9)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659785 (IL9)
SSDB
Other DBs
NCBI-GeneID: 104659785
NCBI-ProteinID: XP_010358209
UniProt: A0A2K6QSK5
LinkDB
Position
3
AA seq 145 aa
MLLAIVLTSALLLCSVAGQGCPTSTGIVRDINFLIDKMQEDAASKCHCSANVTSCLCLPI
PSDNCTGPCFREGLSQMTNTTVQTRYPLIFNRVKKSVEVLRNKKCPNFSCEQPCNQTMAG
NVLTFLKSLLEVFQKEKMRGMGGKI
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcttctggccatagtccttacctctgccctgctcctgtgctccgtggcaggccagggg
tgtccaacctcgacggggatcgtcagggacatcaacttcctcatcgacaagatgcaggaa
gatgcagcttccaagtgccactgcagtgctaatgtgaccagttgtctctgtctgcccatt
ccttctgacaactgcaccggaccatgcttcagggagggactgtctcagatgaccaatacc
acagtgcaaacaagatacccactgattttcaatcgggtgaaaaaatctgttgaagtacta
aggaacaaaaagtgtcccaatttttcttgtgaacagccatgcaaccaaaccatggcaggc
aacgtgctgacatttctgaagagtctcctggaagttttccagaaagaaaagatgagaggg
atgggaggcaaaatatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659834
Entry
104659834         CDS       T03989                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04672  Intestinal immune network for IgA production
rro05140  Leishmaniasis
rro05200  Pathways in cancer
rro05310  Asthma
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659834 (IL4)
   04151 PI3K-Akt signaling pathway
    104659834 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659834 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659834 (IL4)
   04660 T cell receptor signaling pathway
    104659834 (IL4)
   04658 Th1 and Th2 cell differentiation
    104659834 (IL4)
   04659 Th17 cell differentiation
    104659834 (IL4)
   04657 IL-17 signaling pathway
    104659834 (IL4)
   04664 Fc epsilon RI signaling pathway
    104659834 (IL4)
   04672 Intestinal immune network for IgA production
    104659834 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659834 (IL4)
  09163 Immune disease
   05310 Asthma
    104659834 (IL4)
   05320 Autoimmune thyroid disease
    104659834 (IL4)
   05321 Inflammatory bowel disease
    104659834 (IL4)
   05330 Allograft rejection
    104659834 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104659834 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659834 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659834 (IL4)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659834 (IL4)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104659834 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Mannosyl_trans3
Other DBs
NCBI-GeneID: 104659834
NCBI-ProteinID: XP_010358290
UniProt: A0A2K6RBZ7
LinkDB
Position
3
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHNCHNALREIIETLNSLTEQKTLCTELTVTDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaactgccataacgccttacgggagatcatcgaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgatccgattcctgaaacggctggacaggaacctctggggcctggcaggcttg
aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659835
Entry
104659835         CDS       T03989                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13 isoform X1
  KO
K05435  interleukin 13
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04664  Fc epsilon RI signaling pathway
rro05200  Pathways in cancer
rro05310  Asthma
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659835 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659835 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104659835 (IL13)
   04657 IL-17 signaling pathway
    104659835 (IL13)
   04664 Fc epsilon RI signaling pathway
    104659835 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659835 (IL13)
  09163 Immune disease
   05310 Asthma
    104659835 (IL13)
   05321 Inflammatory bowel disease
    104659835 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659835 (IL13)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659835 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 104659835
NCBI-ProteinID: XP_010358292
UniProt: A0A2K6QKZ0
LinkDB
Position
3
AA seq 146 aa
MRPLLNPLLLALGLMELLLTMVIALTYLGGFASPSPVPPSTALKELIEELVNITQNQKAP
LCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSILRVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgtccgctcctcaatcctctcctgttggcactgggcctcatggagctcttattgacc
atggtcattgctctcacttacctcggcggctttgcctccccaagccctgtgcctccctct
acagccctcaaggagctcattgaggagctggtcaacatcacccagaaccagaaggccccg
ctctgcaatggcagcatggtgtggagcatcaacctgacagctggcgtgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
aacggattctgcccgcacaaggtctcagctgggcagttttccatcttgcgtgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659838
Entry
104659838         CDS       T03989                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04672  Intestinal immune network for IgA production
rro05200  Pathways in cancer
rro05310  Asthma
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659838 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659838 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659838 (IL5)
   04660 T cell receptor signaling pathway
    104659838 (IL5)
   04658 Th1 and Th2 cell differentiation
    104659838 (IL5)
   04657 IL-17 signaling pathway
    104659838 (IL5)
   04664 Fc epsilon RI signaling pathway
    104659838 (IL5)
   04672 Intestinal immune network for IgA production
    104659838 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659838 (IL5)
  09163 Immune disease
   05310 Asthma
    104659838 (IL5)
   05320 Autoimmune thyroid disease
    104659838 (IL5)
   05321 Inflammatory bowel disease
    104659838 (IL5)
   05330 Allograft rejection
    104659838 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659838 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659838 (IL5)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659838 (IL5)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104659838 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 104659838
NCBI-ProteinID: XP_010358296
LinkDB
Position
3
AA seq 132 aa
MLLHLSLLALGAAYMYAIPTEIPTSALVKETLALLSTHRTLLIGNETLRIPVPVHKHHQL
CTEEIFQGIGTLESQTVQGGAVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEF
LGVMNTEWIIES
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcttctacatttgagtttgctagctcttggagctgcttacatgtatgccatccccaca
gaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcatcgaact
ctgctgataggcaatgagactctgaggattcctgttcctgtacataaacatcaccaactg
tgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaagggggt
gctgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggccaaaaa
aaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaagagttt
cttggtgtaatgaacaccgagtggataatagaaagttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659848
Entry
104659848         CDS       T03989                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro05146  Amoebiasis
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05171  Coronavirus disease - COVID-19
rro05202  Transcriptional misregulation in cancer
rro05221  Acute myeloid leukemia
rro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659848 (CSF2)
   04668 TNF signaling pathway
    104659848 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659848 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659848 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    104659848 (CSF2)
   04660 T cell receptor signaling pathway
    104659848 (CSF2)
   04657 IL-17 signaling pathway
    104659848 (CSF2)
   04664 Fc epsilon RI signaling pathway
    104659848 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104659848 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104659848 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104659848 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104659848 (CSF2)
   05171 Coronavirus disease - COVID-19
    104659848 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104659848 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104659848 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104659848 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659848 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659848 (CSF2)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     104659848 (CSF2)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104659848 (CSF2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104659848 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 104659848
NCBI-ProteinID: XP_010358313
UniProt: A0A2K6R8E2
LinkDB
Position
3
AA seq 144 aa
MWLQGLLLLGTVACSISAPARSPSPGTQPWERVNAIQEARRLLNLSRDTAAETNKTVEVV
SEMFDLQEPSCLQTRLELYKQGLRGSLTKLEGPLTMMASHYKQHCPPTPETSCATQIITF
QSFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagggcctactgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccggcacgcagccctgggagcgtgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagacgaataaaaccgtagaagttgtc
tcagaaatgtttgacctccaggagccgagctgcctacagacccggctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcgagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttc
caaagtttcaaagaaaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659849
Entry
104659849         CDS       T03989                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04664  Fc epsilon RI signaling pathway
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05221  Acute myeloid leukemia
rro05310  Asthma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659849 (IL3)
   04151 PI3K-Akt signaling pathway
    104659849 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659849 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104659849 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659849 (IL3)
   04664 Fc epsilon RI signaling pathway
    104659849 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659849 (IL3)
   05202 Transcriptional misregulation in cancer
    104659849 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104659849 (IL3)
  09163 Immune disease
   05310 Asthma
    104659849 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659849 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659849 (IL3)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659849 (IL3)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104659849 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 104659849
NCBI-ProteinID: XP_010358314
LinkDB
Position
3
AA seq 143 aa
MSRLPILLLLHLLVSPGLQAPMTQTTSLKTSWANCSNMIDEIITHLKQPPLPSSDFNNLS
GEDQAILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRHPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccatcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaactgctctaacatgatcgat
gaaatcataacacacttaaaacagccacctttgccttcgtcggacttcaacaacctcagt
ggggaagaccaagccattctggtggaaaaaaatcttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaatgcatcagcaatcgagagcattcttaagaatctc
ccgccatgcctgcccatggccacggccgcacccacgcgacatccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctacctgaaaacccttgagaatgag
caggctcaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661556
Entry
104661556         CDS       T03989                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661556 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661556 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661556 (CTF1)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104661556 (CTF1)
SSDB
Motif
Pfam: LIF_OSM pPIWI_RE_X PRF NolB
Other DBs
NCBI-GeneID: 104661556
NCBI-ProteinID: XP_030780719
LinkDB
Position
20
AA seq 201 aa
MSRREGSLEDPQADSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLEVVRRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGTRAEPPAATASAASAAGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGPA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaggacccccaggctgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggctccgagccacgccggg
ctgccggtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggaagtagtgcgccgccgccaggccgagttgaacccgcgcgcgccgcgcctgctgcgc
cgcctagaggacgcggcgcgccaggcccgggccctgggcgccgcagtggaggccttgctg
gccgcgttgggcgcagccaatcgcgggacccgggccgagccccccgccgccaccgcctct
gccgcctccgccgccggggtcttccccgccaaagtgctgggactccgcgtgtgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggcccg
gcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661595
Entry
104661595         CDS       T03989                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661595
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104661595
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 104661595
NCBI-ProteinID: XP_010360588
LinkDB
Position
20
AA seq 203 aa
MSCPLAHLCLLTLLLPPLSSAAPISLAESISQAYSLALYMQKNTSVLLQTYLQYQGSPFS
DPGFSAPELQLSSLPPATAFFKTWRTLDDGERLSLAQGAFLALTQHLQLVRDDQSDLNPG
SPILLAQLGTARLRAQGLLGNMAAIMTALGLPMPPEEDTLGLVTFGASAFERKCLGYVVT
REYGHWTDRAVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagctgtccactggcccacctctgcctgctgaccctgctgttgccacccctcagctca
gcagcccccatctccctggctgagtccatcagtcaagcctatagcctggccctctacatg
cagaagaacacatcagtgctgctgcagacttacctccagtaccagggtagcccctttagt
gaccctggcttctcagcccctgagctccagctcagcagcctgcctcctgccactgccttc
ttcaagacctggcgcaccctagatgatggggaaaggctgagccttgcccagggggccttc
ctggccttgacccagcacctccagctcgtgagggacgaccagagcgacctgaaccctggc
agtcccatcctgctggctcagctcgggactgcaagactcagggcccaaggcctgctaggc
aacatggccgccatcatgacagccctggggctgccaatgcccccagaagaggatactcta
gggcttgtcacctttggggcctcagccttcgagaggaaatgtctaggctacgtggtgacc
cgggaatatggccactggacagaccgagctgtgagggacttggctttgcttaaggccaag
tacccagcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661740
Entry
104661740         CDS       T03989                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04068  FoxO signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04660  T cell receptor signaling pathway
rro04672  Intestinal immune network for IgA production
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05150  Staphylococcus aureus infection
rro05152  Tuberculosis
rro05310  Asthma
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05322  Systemic lupus erythematosus
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661740 (IL10)
   04068 FoxO signaling pathway
    104661740 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661740 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104661740 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104661740 (IL10)
   04660 T cell receptor signaling pathway
    104661740 (IL10)
   04672 Intestinal immune network for IgA production
    104661740 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    104661740 (IL10)
   05322 Systemic lupus erythematosus
    104661740 (IL10)
   05320 Autoimmune thyroid disease
    104661740 (IL10)
   05321 Inflammatory bowel disease
    104661740 (IL10)
   05330 Allograft rejection
    104661740 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104661740 (IL10)
   05133 Pertussis
    104661740 (IL10)
   05150 Staphylococcus aureus infection
    104661740 (IL10)
   05152 Tuberculosis
    104661740 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104661740 (IL10)
   05144 Malaria
    104661740 (IL10)
   05145 Toxoplasmosis
    104661740 (IL10)
   05140 Leishmaniasis
    104661740 (IL10)
   05142 Chagas disease
    104661740 (IL10)
   05143 African trypanosomiasis
    104661740 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661740 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104661740 (IL10)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104661740 (IL10)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104661740 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 104661740
NCBI-ProteinID: XP_010360805
UniProt: A0A2K6RPG6
LinkDB
Position
8
AA seq 178 aa
MHSSALLCCLVLLTGVRASPGQGTHSENSCTRFPGNVPHMLRDLRDAFSRVKTFFQMKDQ
LDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKMQN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccattctgagaacagctgcacccgcttcccaggcaacgtgcctcacatg
cttcgagacctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacatattattaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
cacgacccagacatcaaggagcatgtgaactccctgggggagaatctgaagaccctcagg
ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggctgtggag
caggtgaagaatgcctttagtaagctccaagagaaaggcgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatgcaaaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661741
Entry
104661741         CDS       T03989                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19 isoform X1
  KO
K05444  interleukin 19
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661741 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661741 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104661741 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661741 (IL19)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104661741 (IL19)
SSDB
Motif
Pfam: IL10 DUF1741
Other DBs
NCBI-GeneID: 104661741
NCBI-ProteinID: XP_010360806
LinkDB
Position
8
AA seq 231 aa
MIFSIEQCLYTLTGVQECALRERFHTDLHVPYLSHVCTHISVCVPVLWGSVPWGMKLHCV
SLWLLGTILMLCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETL
QIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQ
CHCRQEATNVTRVIHDNYDQLEVRSAAIKSLGELDIFLAWIAKNHEVTSSA
NT seq 696 nt   +upstreamnt  +downstreamnt
atgattttctccatcgagcagtgcttgtacacactgacaggagtccaagaatgtgcacta
agggagcgtttccacacagatctgcatgttccttacctctcacatgtgtgtacacatata
tccgtgtgtgtgccagtgctttggggctctgttccatggggcatgaagttacattgtgtt
tccctttggctcctgggtacaatactgatgttgtgctcagtagacaaccatggtctcagg
agatgtctgatttccacagacatgcaccatatagaagagagtttccaagaaatcaaaaga
gccatccaagctaaggacaccttcccaaatgtcactatcctgtccacattggagactctg
cagatcattaagcccttagatgtgtgctgtgtgaccaagaatctcctagcattctacgtg
gacagggtgttcaaggatcatcaagagccaaaccccaaaatcttgagaaaaatcagcagc
attgccaactctttcctctacatgcagaaaactctgcggcaatgtcaggaacagaggcag
tgtcactgcaggcaggaagctaccaatgtcaccagagtcatccacgacaactatgatcag
ctggaggtccgctctgctgccatcaaatccctgggagagctcgacatctttctagcctgg
attgctaagaatcatgaagtaacgtcctcagcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661748
Entry
104661748         CDS       T03989                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04151  PI3K-Akt signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04672  Intestinal immune network for IgA production
rro04940  Type I diabetes mellitus
rro05135  Yersinia infection
rro05142  Chagas disease
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661748 (IL2)
   04151 PI3K-Akt signaling pathway
    104661748 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661748 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104661748 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104661748 (IL2)
   04660 T cell receptor signaling pathway
    104661748 (IL2)
   04658 Th1 and Th2 cell differentiation
    104661748 (IL2)
   04659 Th17 cell differentiation
    104661748 (IL2)
   04672 Intestinal immune network for IgA production
    104661748 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661748 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104661748 (IL2)
   05321 Inflammatory bowel disease
    104661748 (IL2)
   05330 Allograft rejection
    104661748 (IL2)
   05332 Graft-versus-host disease
    104661748 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104661748 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104661748 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661748 (IL2)
   05171 Coronavirus disease - COVID-19
    104661748 (IL2)
   05162 Measles
    104661748 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104661748 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661748 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104661748 (IL2)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104661748 (IL2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104661748 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 104661748
NCBI-ProteinID: XP_010360811
UniProt: A0A2K6NXW2
LinkDB
Position
2
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagatactaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661749
Entry
104661749         CDS       T03989                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661749 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661749 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104661749 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    104661749 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661749 (IL21)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104661749 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 104661749
NCBI-ProteinID: XP_010360812
UniProt: A0A2K6NA36
LinkDB
Position
2
AA seq 162 aa
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRL
TCPSCASYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggatagtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgttttcag
aaggcccaactaaagtcagccaatacaggaaacaatgaaaggataatcaatttatcaatt
aaaaagctgaagaggaaatcaccttccacaggtgcagagagaagacagaaacacagacta
acatgcccttcatgtgcttcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacatggaagtgaa
gattcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664085
Entry
104664085         CDS       T03989                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03050  Proteasome
rro04060  Cytokine-cytokine receptor interaction
rro04066  HIF-1 signaling pathway
rro04217  Necroptosis
rro04350  TGF-beta signaling pathway
rro04380  Osteoclast differentiation
rro04612  Antigen processing and presentation
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04940  Type I diabetes mellitus
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05321  Inflammatory bowel disease
rro05322  Systemic lupus erythematosus
rro05323  Rheumatoid arthritis
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    104664085 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104664085 (IFNG)
   04630 JAK-STAT signaling pathway
    104664085 (IFNG)
   04066 HIF-1 signaling pathway
    104664085 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664085 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104664085 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104664085 (IFNG)
   04612 Antigen processing and presentation
    104664085 (IFNG)
   04660 T cell receptor signaling pathway
    104664085 (IFNG)
   04658 Th1 and Th2 cell differentiation
    104664085 (IFNG)
   04659 Th17 cell differentiation
    104664085 (IFNG)
   04657 IL-17 signaling pathway
    104664085 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104664085 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664085 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104664085 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    104664085 (IFNG)
   05323 Rheumatoid arthritis
    104664085 (IFNG)
   05321 Inflammatory bowel disease
    104664085 (IFNG)
   05330 Allograft rejection
    104664085 (IFNG)
   05332 Graft-versus-host disease
    104664085 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104664085 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104664085 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104664085 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104664085 (IFNG)
   05164 Influenza A
    104664085 (IFNG)
   05168 Herpes simplex virus 1 infection
    104664085 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104664085 (IFNG)
   05144 Malaria
    104664085 (IFNG)
   05145 Toxoplasmosis
    104664085 (IFNG)
   05140 Leishmaniasis
    104664085 (IFNG)
   05142 Chagas disease
    104664085 (IFNG)
   05143 African trypanosomiasis
    104664085 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rro03051]
    104664085 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104664085 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104664085 (IFNG)
Proteasome [BR:rro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104664085 (IFNG)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104664085 (IFNG)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104664085 (IFNG)
SSDB
Motif
Pfam: IFN-gamma Tup_N
Other DBs
NCBI-GeneID: 104664085
NCBI-ProteinID: XP_010363825
UniProt: A0A2K6PM05
LinkDB
Position
10
AA seq 165 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt
aatgtcaagtttttcaatagcaacaaaaagaaacgggatgacttcgaaaagctgaccaat
tattcggtaactgacttgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagatgtttcgaggt
cgaagagcatcccagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664191
Entry
104664191         CDS       T03989                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664191 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664191 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104664191 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104664191 (IL24)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104664191 (IL24)
SSDB
Motif
Pfam: IL22 IL10
Other DBs
NCBI-GeneID: 104664191
NCBI-ProteinID: XP_030790794
LinkDB
Position
8
AA seq 210 aa
MSLWVTGPASQAASLSFSRPFCPPLLVTVSQMQMAVLPCLGLILLLWSQVPGAQGREFQF
GPCQVKGVVPQKLWEAFWAVKDTVQAQDNIRSVRLLQQEVLQNVSDAESCYLVHTLLEFY
LKTVFKNYHNRTFEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRA
FKQLDIEAALTKALGEVDILLTWMQQFYKL
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcactctgggtcacagggccggcctcacaggctgcctccctttctttcagcagaccc
ttctgccctcctttgctggtgacggtctcccaaatgcagatggctgtgctcccttgcctg
ggtcttatcttgcttctctggagccaggtgccaggggcccagggccgagaattccaattt
gggccctgccaagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtg
aaagacactgtgcaagctcaggataacatcaggagtgtccggctgctgcagcaggaggtt
ctgcagaatgtctcggatgctgagagctgttaccttgtccacaccctgctggagttctac
ttgaaaactgttttcaaaaactaccacaatagaacatttgaagtcaggactctgaagtca
ttctctactctggccaacaactttgttctcatcgtgtcacaactgcaacccagtcaggaa
aatgagatgttttccatcagagacagtgcacacaggcggtttctgctattccggagagca
ttcaaacagttggacatagaagcagctctgaccaaagctcttggggaagtggacattctt
ctgacctggatgcagcaattctacaagctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664194
Entry
104664194         CDS       T03989                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664194 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664194 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104664194 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104664194 (IL20)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104664194 (IL20)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 104664194
NCBI-ProteinID: XP_010363969
UniProt: A0A2K6RT36
LinkDB
Position
8
AA seq 176 aa
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNT
DIRILRRTESLQDTKPGDQCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLQLCHAHMTCHCGEEAMKKYGQILSHFEELEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctagtcttgccttcagccttctctctgctgcgttttacctcctatggact
ccttccactggactgaagacactcaatttgggaagctgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacact
gacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctggggatcagtgc
tgtcttctacgccatttgctaagactctacctggacagagtatttaaaaactaccagacc
cccgaccattatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccagctctgtcatgcccacatgacatgccattgtggggaggaagcaatgaag
aaatacggccagattctgagtcactttgaagagctggagcctcaggcagcagttgtgaag
gctttgggggaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665012
Entry
104665012         CDS       T03989                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha isoform X1
  KO
K05406  interleukin 12A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04620  Toll-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04940  Type I diabetes mellitus
rro05133  Pertussis
rro05134  Legionellosis
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05162  Measles
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665012 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665012 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104665012 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    104665012 (IL12A)
   04625 C-type lectin receptor signaling pathway
    104665012 (IL12A)
   04658 Th1 and Th2 cell differentiation
    104665012 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665012 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104665012 (IL12A)
   05330 Allograft rejection
    104665012 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104665012 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104665012 (IL12A)
   05134 Legionellosis
    104665012 (IL12A)
   05152 Tuberculosis
    104665012 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104665012 (IL12A)
   05164 Influenza A
    104665012 (IL12A)
   05162 Measles
    104665012 (IL12A)
   05168 Herpes simplex virus 1 infection
    104665012 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665012 (IL12A)
   05144 Malaria
    104665012 (IL12A)
   05145 Toxoplasmosis
    104665012 (IL12A)
   05140 Leishmaniasis
    104665012 (IL12A)
   05142 Chagas disease
    104665012 (IL12A)
   05143 African trypanosomiasis
    104665012 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104665012 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104665012 (IL12A)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104665012 (IL12A)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104665012 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 104665012
NCBI-ProteinID: XP_010365006
UniProt: A0A2K6REW5
LinkDB
Position
1
AA seq 253 aa
MWPPGSASQPPPSPATATGLHPAARPVSLQCQLSMCPARSLLLMATLVLLDYLSLARNLS
VATPVPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACL
PLELIKNESCLNSRETSFTTNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLGVIDELMQALNFSSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcgcagccaccgccctcacctgccacggccacaggtctg
catccagcggctcgcccagtgtccctgcagtgccagctcagcatgtgtccagcgcgcagc
ctcctccttatggccaccctggtcctcctggactacctcagtttggccagaaacctctcc
gtggccaccccagtcccagaaatgttcccatgccttcaccactcccaaaacctgctgaag
gccgccagcaacacgctccagaaggccagacaaattctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaatcaagaatgagagttgcctaaattccagagagacctctttcacaact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctgggcgttattgacgagctg
atgcaggccctgaatttcagcagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttacaaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665836
Entry
104665836         CDS       T03989                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665836 (IL7)
   04151 PI3K-Akt signaling pathway
    104665836 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104665836 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104665836 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665836 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104665836 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104665836 (IL7)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104665836 (IL7)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104665836 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 104665836
NCBI-ProteinID: XP_010366063
UniProt: A0A2K6NZH1
LinkDB
Position
9
AA seq 177 aa
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHLCDDNKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGK
VKGRKPAALGEPQPTKSLEENKSLKEQKKLNDSCFLKRLLQKIKTCWNKILMGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatttatgtgatgataataaggaaggtatgttc
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactattgaactgcactggcaag
gttaaaggaagaaaaccagctgccctgggtgaaccccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgactcgtgtttcctaaagagactacta
caaaagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668275
Entry
104668275         CDS       T03989                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104668275 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104668275 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104668275 (IL17D)
   04659 Th17 cell differentiation
    104668275 (IL17D)
   04657 IL-17 signaling pathway
    104668275 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104668275 (IL17D)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104668275 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 104668275
NCBI-ProteinID: XP_030777793
LinkDB
Position
18
AA seq 209 aa
MLGALVWMLVAGFLLALPPGWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAVGVLSA
FHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAY
CLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEP
EKDADSINSSIDKQGTKLLLGPNDAPAGP
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttgggggcactggtctggatgctggtagccggcttcctgctggcgctgccgcccggc
tgggccgcgggcgccccgagagcgggcaggcgcccggcgcggccgcggggctgcgcggac
cggccggaggagctcctggagcagctgtacgggcgcctggctgtcggcgtgctcagcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgcaacgcgagctgcccagca
gggggcaggcccgccgaccgccgcttccggccgcccaccaacctgcgcagcgtgtcgccc
tgggcctacagaatctcctacgacccggcgaggtacccccggtacctgcctgaagcctac
tgcctgtgccggggctgcctgaccgggctgttcggcgaggaggacgtgcgcttccgcagc
gccccagtctacatgcccaccgtggtgctgcgccgcacccccgcctgcgccggcggccgt
tccgtctataccgaggcctacgtcaccatccccgtgggctgcacctgcgtccccgagcca
gagaaggacgcagacagcatcaactccagcatcgacaaacagggcaccaagctcctgctg
ggccccaacgacgcgcccgctggcccctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669104
Entry
104669104         CDS       T03989                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04620  Toll-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04940  Type I diabetes mellitus
rro05133  Pertussis
rro05134  Legionellosis
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05162  Measles
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104669104 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104669104 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104669104 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    104669104 (IL12B)
   04625 C-type lectin receptor signaling pathway
    104669104 (IL12B)
   04658 Th1 and Th2 cell differentiation
    104669104 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669104 (IL12B)
   05205 Proteoglycans in cancer
    104669104 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104669104 (IL12B)
   05330 Allograft rejection
    104669104 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104669104 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104669104 (IL12B)
   05134 Legionellosis
    104669104 (IL12B)
   05152 Tuberculosis
    104669104 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104669104 (IL12B)
   05164 Influenza A
    104669104 (IL12B)
   05162 Measles
    104669104 (IL12B)
   05168 Herpes simplex virus 1 infection
    104669104 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104669104 (IL12B)
   05145 Toxoplasmosis
    104669104 (IL12B)
   05140 Leishmaniasis
    104669104 (IL12B)
   05142 Chagas disease
    104669104 (IL12B)
   05143 African trypanosomiasis
    104669104 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104669104 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104669104 (IL12B)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104669104 (IL12B)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Cytokines
   104669104 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_2 Ig_5 Ig_3 Ig_4 fn3 I-set
Other DBs
NCBI-GeneID: 104669104
NCBI-ProteinID: XP_030782504
LinkDB
Position
3
AA seq 328 aa
MCHQQLVISWFSLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSIKSSRGSSNPQGVTCGAPTLSAERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVIC
RKNASFSVQAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagctggtcatctcttggttttccctggtttttctggcatctcccctc
atggccatatgggaactgaagaaagacgtttatgttgtagaattggattggtacccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagtggtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggctctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaagccaaaaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatctgacattcagtatcaaaagcagcaga
ggctcttctaacccccaaggggtgacgtgcggagcccctacactctctgcagagagggtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gccgctgaggagaggctgcctattgaggtcatggtggatgccattcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacccgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcattcaggtccagggcaag
agcaagagagaaaagaaagatagaatcttcacagacaagacctcagccacggtcatctgc
cgcaaaaatgccagctttagcgtgcaggcccaggaccgctactacagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670273
Entry
104670273         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670273
   04151 PI3K-Akt signaling pathway
    104670273
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670273
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670273
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670273
   04621 NOD-like receptor signaling pathway
    104670273
   04622 RIG-I-like receptor signaling pathway
    104670273
   04623 Cytosolic DNA-sensing pathway
    104670273
   04650 Natural killer cell mediated cytotoxicity
    104670273
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670273
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670273
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670273
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670273
   05161 Hepatitis B
    104670273
   05160 Hepatitis C
    104670273
   05171 Coronavirus disease - COVID-19
    104670273
   05164 Influenza A
    104670273
   05162 Measles
    104670273
   05168 Herpes simplex virus 1 infection
    104670273
   05163 Human cytomegalovirus infection
    104670273
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670273
   05169 Epstein-Barr virus infection
    104670273
   05165 Human papillomavirus infection
    104670273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670273
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670273
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104670273
NCBI-ProteinID: XP_010371756
LinkDB
Position
16
AA seq 190 aa
MMALPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTMMLLAQMSRISPSSCLMDRHEF
GFPQQEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAVWDEDLLDKFCTELYQQLNDL
EACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRVEIMRSFSLST
NLQERLRRKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggcattgccctttgctttactgatggctctggtggtgctcagctgcaagtcaagc
tgctctctgggctgtgatctgcctgagacccacagcctggataacaggaggaccatgatg
ctcctggcacagatgagcagaatctctccttcctcctgtctgatggacagacatgagttt
ggatttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagatcttcaacctgtttaccacaaaagactcatctgctgtt
tgggatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttg
gaagcctgtgtgatgcagcaggagagggtgggagaaactcccctgatgaatgcggactcc
accttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagtagaaatcatgagatctttctctttatcaaca
aacttgcaggaaagattaaggaggaaggaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670274
Entry
104670274         CDS       T03989                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04622  RIG-I-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670274
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670274
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    104670274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670274
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670274
SSDB
Motif
Pfam: Interferon LuxQ-periplasm
Other DBs
NCBI-GeneID: 104670274
NCBI-ProteinID: XP_010371757
LinkDB
Position
16
AA seq 195 aa
MASLYSLVVALVVCSCGSFGSLGCDLPQNHSLIGKKTLVLLGQMKWISLFLYLKDRRDFR
FPQEMVEVSQLQKAQTMSVLHKMLQQIFSLFNTECSSAAWNMTLLDQLHTGLHQQLEYLE
TCLVQAVGEGESAGVIGSPTLALRRYFQGIRLFLKEKKHSDCAWEVVRVEVMRSFSLSTN
SQQRLRSKEGDMEYS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccagcctctactctctggtggtggccctagtagtgtgcagctgtggctcttttgga
tcgctgggatgtgacctgcctcagaaccatagtctgataggaaagaagactttggtgctt
ctgggccaaatgaaatggatctcccttttcttgtaccttaaggacagaagagacttcaga
tttccccaggagatggtggaagtcagccagttgcagaaggcccagactatgtctgtcctc
cataagatgctgcagcagatcttcagcctcttcaacacagagtgctcctctgctgcctgg
aacatgaccctcctggaccagctccatactggacttcatcagcagctagaatacctggag
acctgcttggttcaggcagtgggagagggagaatctgctggggtgattgggagccctaca
ctggccttgagaaggtacttccagggaatccgtctcttcctgaaagagaagaaacatagt
gactgtgcctgggaagttgtcagagtggaagtcatgagatccttctctttatcaacaaac
tcacaacaaagattgagaagtaaggaaggagacatggagtactcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670275
Entry
104670275         CDS       T03989                                 

Gene name
IFNA8
Definition
(RefSeq) interferon alpha-8
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670275 (IFNA8)
   04151 PI3K-Akt signaling pathway
    104670275 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670275 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670275 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670275 (IFNA8)
   04621 NOD-like receptor signaling pathway
    104670275 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    104670275 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    104670275 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    104670275 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670275 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670275 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670275 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670275 (IFNA8)
   05161 Hepatitis B
    104670275 (IFNA8)
   05160 Hepatitis C
    104670275 (IFNA8)
   05171 Coronavirus disease - COVID-19
    104670275 (IFNA8)
   05164 Influenza A
    104670275 (IFNA8)
   05162 Measles
    104670275 (IFNA8)
   05168 Herpes simplex virus 1 infection
    104670275 (IFNA8)
   05163 Human cytomegalovirus infection
    104670275 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670275 (IFNA8)
   05169 Epstein-Barr virus infection
    104670275 (IFNA8)
   05165 Human papillomavirus infection
    104670275 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670275 (IFNA8)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670275 (IFNA8)
SSDB
Motif
Pfam: Interferon Transcrip_act
Other DBs
NCBI-GeneID: 104670275
NCBI-ProteinID: XP_010371758
LinkDB
Position
16
AA seq 184 aa
MALTFYLLMALVVLSYKPFSSLGCDLPQTHSLGYRRALVLLAQMRRISPFSCLKDRHDFE
FPQEEFDDKNFQKAQAISVLHEIIQQTFNLFITKNSFTAFNETLLDEFYIELDQQLNDLE
SCEMQEVGVTETHLMYEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSIN
LQKD
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccttgaccttttatttactgatggccctagtggtgctcagctacaagccattcagc
tctctgggctgtgatctgcctcagacccacagcctgggttacaggagggccttggtgctc
ctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttcccccaggaggagtttgatgataaaaacttccagaaggctcaagccatctctgttctc
catgagataatccagcagaccttcaacctcttcatcacaaagaattcatttactgctttt
aatgagacccttctagatgagttctacatcgaacttgaccagcagctgaatgacctggag
tcctgtgagatgcaggaagtgggggtgacagagactcacctgatgtatgaggactccatc
ctggctgtgaagaaatacttccaaagaattactctatatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaagattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670276
Entry
104670276         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670276
   04151 PI3K-Akt signaling pathway
    104670276
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670276
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670276
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670276
   04621 NOD-like receptor signaling pathway
    104670276
   04622 RIG-I-like receptor signaling pathway
    104670276
   04623 Cytosolic DNA-sensing pathway
    104670276
   04650 Natural killer cell mediated cytotoxicity
    104670276
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670276
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670276
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670276
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670276
   05161 Hepatitis B
    104670276
   05160 Hepatitis C
    104670276
   05171 Coronavirus disease - COVID-19
    104670276
   05164 Influenza A
    104670276
   05162 Measles
    104670276
   05168 Herpes simplex virus 1 infection
    104670276
   05163 Human cytomegalovirus infection
    104670276
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670276
   05169 Epstein-Barr virus infection
    104670276
   05165 Human papillomavirus infection
    104670276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670276
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670276
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104670276
NCBI-ProteinID: XP_010371759
LinkDB
Position
16
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPQTHSLDNRRTMMLLKQMSRISPSSCLMDRHDFG
FPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAVWDEDLLDKFCTELYQQLNDLE
ACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSFSTN
LQERLRREE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctcagacccacagcctggataacaggaggaccatgatgctc
ctgaaacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccagcaggaatttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagaccttcaacctgtttaccacaaaagactcatctgctgtttgg
gatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcagcaggagagggtgggagaaactcccctgatgaatgcggactccacc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgcaagaaagattaaggagggaggaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670278
Entry
104670278         CDS       T03989                                 

Gene name
IFNA6
Definition
(RefSeq) interferon alpha-6
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670278 (IFNA6)
   04151 PI3K-Akt signaling pathway
    104670278 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670278 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670278 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670278 (IFNA6)
   04621 NOD-like receptor signaling pathway
    104670278 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    104670278 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    104670278 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    104670278 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670278 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670278 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670278 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670278 (IFNA6)
   05161 Hepatitis B
    104670278 (IFNA6)
   05160 Hepatitis C
    104670278 (IFNA6)
   05171 Coronavirus disease - COVID-19
    104670278 (IFNA6)
   05164 Influenza A
    104670278 (IFNA6)
   05162 Measles
    104670278 (IFNA6)
   05168 Herpes simplex virus 1 infection
    104670278 (IFNA6)
   05163 Human cytomegalovirus infection
    104670278 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670278 (IFNA6)
   05169 Epstein-Barr virus infection
    104670278 (IFNA6)
   05165 Human papillomavirus infection
    104670278 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670278 (IFNA6)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670278 (IFNA6)
SSDB
Motif
Pfam: Interferon DDHD ORF6C
Other DBs
NCBI-GeneID: 104670278
NCBI-ProteinID: XP_010371760
LinkDB
Position
16
AA seq 189 aa
MVLPFALLMALVVLSCKSSCSLGCDLPQTHSLDNRRTMMLLAQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAQAISVLHEVIQQTYNLFSTKDSSAAWDERLLDKLYTELYQQLNDLE
ACVMQEAWVGETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQEKLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtcctgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctcagacccacagcctggataacaggaggaccatgatgctc
ctggcgcaaatgaggagaatctctcttttctcctgtctgaaggacagacacgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctcaagctatctctgtcctc
catgaggtgatccagcagacctacaacctcttcagcacaaaggactcatctgctgcttgg
gatgaaaggcttctagacaaactctacactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggcgtgggtgggagagactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaagaagtatagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaaaattaaggaggaaagaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670280
Entry
104670280         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-14
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670280
   04151 PI3K-Akt signaling pathway
    104670280
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670280
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670280
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670280
   04621 NOD-like receptor signaling pathway
    104670280
   04622 RIG-I-like receptor signaling pathway
    104670280
   04623 Cytosolic DNA-sensing pathway
    104670280
   04650 Natural killer cell mediated cytotoxicity
    104670280
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670280
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670280
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670280
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670280
   05161 Hepatitis B
    104670280
   05160 Hepatitis C
    104670280
   05171 Coronavirus disease - COVID-19
    104670280
   05164 Influenza A
    104670280
   05162 Measles
    104670280
   05168 Herpes simplex virus 1 infection
    104670280
   05163 Human cytomegalovirus infection
    104670280
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670280
   05169 Epstein-Barr virus infection
    104670280
   05165 Human papillomavirus infection
    104670280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670280
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670280
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 104670280
NCBI-ProteinID: XP_010371764
LinkDB
Position
16
AA seq 189 aa
MALPFALMMALLVFSYKSSCSLGCNPSQTHSMNNRRTLMLMAQMRRISPFSCLKDRHDFA
FPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLE
ACVIQEVGVEETPLMNEDSVLAVKEYFQRITLYLLEKKYSPCAWEVVRTEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccctttgctttaatgatggccctgctggtgtttagctacaagtcaagctgc
tctctgggctgtaatccatctcaaacccacagcatgaataacaggaggactttgatgctc
atggcacaaatgaggagaatctctcctttttcgtgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaagactcaagccatctctgtcctc
catgaaatgatccagcagaccttcaatctcttcagcacgaaggactcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaactaaatgacctggaa
gcctgtgtgatacaggaggttggagtggaagagactcccctgatgaatgaggactccgtc
ctggctgtgaaggaatacttccaaagaattacactctatctgttggagaagaaatacagc
ccttgtgcctgggaggttgtcagaacagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670290
Entry
104670290         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-4
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670290
   04151 PI3K-Akt signaling pathway
    104670290
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670290
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670290
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670290
   04621 NOD-like receptor signaling pathway
    104670290
   04622 RIG-I-like receptor signaling pathway
    104670290
   04623 Cytosolic DNA-sensing pathway
    104670290
   04650 Natural killer cell mediated cytotoxicity
    104670290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670290
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670290
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670290
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670290
   05161 Hepatitis B
    104670290
   05160 Hepatitis C
    104670290
   05171 Coronavirus disease - COVID-19
    104670290
   05164 Influenza A
    104670290
   05162 Measles
    104670290
   05168 Herpes simplex virus 1 infection
    104670290
   05163 Human cytomegalovirus infection
    104670290
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670290
   05169 Epstein-Barr virus infection
    104670290
   05165 Human papillomavirus infection
    104670290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670290
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670290
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104670290
NCBI-ProteinID: XP_010371771
LinkDB
Position
16
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLNDLE
ACVTQEVGLEEILLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEVMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttaatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaatctcctagaaaaattttccacggaactttaccagcaactgaatgacctggaa
gcctgcgtgacacaggaggttggattggaagagattctgctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670292
Entry
104670292         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-10-like
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670292
   04151 PI3K-Akt signaling pathway
    104670292
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670292
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670292
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670292
   04621 NOD-like receptor signaling pathway
    104670292
   04622 RIG-I-like receptor signaling pathway
    104670292
   04623 Cytosolic DNA-sensing pathway
    104670292
   04650 Natural killer cell mediated cytotoxicity
    104670292
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670292
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670292
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670292
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670292
   05161 Hepatitis B
    104670292
   05160 Hepatitis C
    104670292
   05171 Coronavirus disease - COVID-19
    104670292
   05164 Influenza A
    104670292
   05162 Measles
    104670292
   05168 Herpes simplex virus 1 infection
    104670292
   05163 Human cytomegalovirus infection
    104670292
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670292
   05169 Epstein-Barr virus infection
    104670292
   05165 Human papillomavirus infection
    104670292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670292
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670292
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104670292
NCBI-ProteinID: XP_010371772
LinkDB
Position
16
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLSCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHELIQQTFNLLSTKDSSAAWEQNLLEKFSTELYQQLNDLE
ACVMQEVGVEETPLMNEDPILAVRKYFQRITLYLMEKKYSRCAWEVVRAEIMRSLSFSTN
LRERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgagctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
ttcccccaggaggagtttgacggcaaccagttccagaaggctcaagccatctctgtcctc
catgagctgatccagcagaccttcaatctcctcagcacaaaggactcatctgctgcttgg
gaacagaatctcctagaaaaattttccacggaactttaccagcaactgaatgacctggaa
gcctgtgtgatgcaggaggttggagtggaagagactcccttgatgaatgaggaccccatc
ctggctgtgaggaaatacttccaaagaatcaccctctatctgatggagaagaaatacagc
cgttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttacgagaaagattaaggaggaaggaatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670294
Entry
104670294         CDS       T03989                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04622  RIG-I-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670294
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670294
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    104670294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670294
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670294
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 104670294
NCBI-ProteinID: XP_010371774
LinkDB
Position
16
AA seq 195 aa
MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVEGSQLQKAQVMSVLHEMLQQIFNLFHTERSSAAWNTTLLDHLHTGLHRQLEHLE
TCLVQIMREGESAGAIRSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN
MQERLRSKDGDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccctcctgttccctctactggcagccctagtgatgaccagctatagtcctgttgga
tctctgggctgtgatctgcctcagaaccatggcctacttagcaggaacaccttggtgctt
ctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaagagacttcagg
ttcccccaggagatggtagaagggagccagttgcagaaggcccaggtcatgtctgtcctc
catgagatgctacagcagatcttcaacctcttccacacagagcgctcctctgctgcctgg
aacacgaccctcctagaccatctccacactggacttcatcggcaactagaacacctggag
acctgcttggtgcagataatgcgagaaggggaatctgctggggcaattaggagccctgca
ctgaccttgaggaggtacttccagggaatccgtgtctacctgaaggagaagaaatacagc
gactgtgcctgggaagttgtcagaatggaaatcatgaaatccttgttcttatcaacaaac
atgcaagaaagactgagaagtaaagatggagacctggggtcatcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670295
Entry
104670295         CDS       T03989                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04668  TNF signaling pathway
rro05135  Yersinia infection
rro05142  Chagas disease
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670295 (IFNB1)
   04668 TNF signaling pathway
    104670295 (IFNB1)
   04151 PI3K-Akt signaling pathway
    104670295 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104670295 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670295 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104670295 (IFNB1)
   04621 NOD-like receptor signaling pathway
    104670295 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    104670295 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    104670295 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    104670295 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104670295 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104670295 (IFNB1)
   05152 Tuberculosis
    104670295 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104670295 (IFNB1)
   05161 Hepatitis B
    104670295 (IFNB1)
   05160 Hepatitis C
    104670295 (IFNB1)
   05171 Coronavirus disease - COVID-19
    104670295 (IFNB1)
   05164 Influenza A
    104670295 (IFNB1)
   05162 Measles
    104670295 (IFNB1)
   05168 Herpes simplex virus 1 infection
    104670295 (IFNB1)
   05163 Human cytomegalovirus infection
    104670295 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670295 (IFNB1)
   05169 Epstein-Barr virus infection
    104670295 (IFNB1)
   05165 Human papillomavirus infection
    104670295 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104670295 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104670295 (IFNB1)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104670295 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104670295
NCBI-ProteinID: XP_010371775
UniProt: A0A2K6N8V0
LinkDB
Position
16
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLATVYHQIDHLK
TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINK
LTGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag
ctcctgtggcaattgaatggaaggcttgaatattgcctcaaggacaggatgaactttgac
atccctgaggaaattaagcagccgcagcagttccagaaggaggacgctgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagatttatctagcactggctgg
aatgagactattgttgagaacctccttgctactgtctatcatcagatagaccatctgaag
acaatcctagaagaaaaactggagaaagaagatttcaccagggggaaattcatgagcagt
ctgcacctgaaaagatactatggaaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctcaggaattttttcttcattaacaaa
cttacaggttacctcagaaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671750
Entry
104671750         CDS       T03989                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04622  RIG-I-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104671750 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104671750 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    104671750 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104671750 (IFNE)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104671750 (IFNE)
SSDB
Motif
Pfam: Interferon DUF1027 Glu-tRNAGln NQRA
Other DBs
NCBI-GeneID: 104671750
NCBI-ProteinID: XP_010373658
LinkDB
Position
16
AA seq 193 aa
MIIKHFFEIVLVLLASTTVFSLDLKLILFQQRRVNQESLKLLNKLQTSSIHLCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHMEKFLIQLHQQLEYL
EALMGLETEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSSCAWAIVQVEINRCLFFVF
SLTEKLSKQGTDP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttgaaattgtgttggtgctgctggcctctaccactgtcttc
tctctagatttgaaactgattctcttccagcaaagaagagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaacctcgtcaattcacctgtgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacatactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaatcacatggagaaattcctcattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaaacagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcagctgtgcctgggccattgtccaagtagaaatcaaccgatgtcttttctttgtgttc
agtctcacagaaaagctgagcaaacaaggaacagacccttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671768
Entry
104671768         CDS       T03989                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 isoform X1
  KO
K05433  interleukin 15
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04668  TNF signaling pathway
rro04672  Intestinal immune network for IgA production
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104671768 (IL15)
   04668 TNF signaling pathway
    104671768 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104671768 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    104671768 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671768 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104671768 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104671768 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104671768 (IL15)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104671768 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 104671768
NCBI-ProteinID: XP_010373688
UniProt: A0A2K6PYS5
LinkDB
Position
2
AA seq 162 aa
MRISKPHLRSSSIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANN
VLSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtagttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggctccctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatccatgcatattgatgctactttatatacagaaagtgatgttcac
cccagttgcaaagtcacagcaatgaagtgctttctcttggagttgcaagttatttcacat
gagtctggagatacagatattcatgatacagtagaaaatcttatcatcctagcaaacaac
gtcttgtcttctaatgggaatataacagaatctggatgcaaagaatgtgaggaactagag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaat
acttcttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673677
Entry
104673677         CDS       T03989                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro05133  Pertussis
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104673677 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104673677 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104673677 (IL23A)
   04659 Th17 cell differentiation
    104673677 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673677 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104673677 (IL23A)
   05321 Inflammatory bowel disease
    104673677 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104673677 (IL23A)
   05152 Tuberculosis
    104673677 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104673677 (IL23A)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104673677 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 104673677
NCBI-ProteinID: XP_010376090
UniProt: A0A2K6RW56
LinkDB
Position
10
AA seq 189 aa
MLGSRAVMLLLLLSWTAQGRAVPGGSSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgtcctggacagctcagggcagg
gctgtgcctgggggcagcagccctgcctgggctcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggattcgccagggtctgattttttac
gagaagctactaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctgctgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagtcccagtcccagccagccatggcagcgcctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagctgcccgggtcttt
gcccatggagcagcaaccctgagcccctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674791
Entry
104674791         CDS       T03989                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11 isoform X1
  KO
K05417  interleukin 11
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104674791 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104674791 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104674791 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    104674791 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104674791 (IL11)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104674791 (IL11)
SSDB
Motif
Pfam: IL11 CLZ DUF4763
Other DBs
NCBI-GeneID: 104674791
NCBI-ProteinID: XP_030798062
LinkDB
Position
12
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQL
KDNFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLK
ALEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPVPPLAPPSSTWGGVRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtt
gcccctgggccaccacctggctcccctcgagcttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggaggacacgcggcagctgactatacagctg
aaggacaatttcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccgagtgtgctgacaaggctgcgagcagac
ttactgtcctacctgcggcatgtgcagtggctgcgccgggcaatgggctcttccctgaag
gccctggagcccgagctgggcaccctgcagacccggctggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagctgcccccagacccaccggtgcccccg
ctggcgcccccctcctcaacctgggggggcgtcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgagggggctactgctgctgaagactcggctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675233
Entry
104675233         CDS       T03989                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01523  Antifolate resistance
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
rro04668  TNF signaling pathway
rro04672  Intestinal immune network for IgA production
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05010  Alzheimer disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05135  Yersinia infection
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05332  Graft-versus-host disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675233 (IL6)
   04668 TNF signaling pathway
    104675233 (IL6)
   04066 HIF-1 signaling pathway
    104675233 (IL6)
   04068 FoxO signaling pathway
    104675233 (IL6)
   04151 PI3K-Akt signaling pathway
    104675233 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104675233 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104675233 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104675233 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104675233 (IL6)
   04620 Toll-like receptor signaling pathway
    104675233 (IL6)
   04621 NOD-like receptor signaling pathway
    104675233 (IL6)
   04623 Cytosolic DNA-sensing pathway
    104675233 (IL6)
   04625 C-type lectin receptor signaling pathway
    104675233 (IL6)
   04659 Th17 cell differentiation
    104675233 (IL6)
   04657 IL-17 signaling pathway
    104675233 (IL6)
   04672 Intestinal immune network for IgA production
    104675233 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675233 (IL6)
   05202 Transcriptional misregulation in cancer
    104675233 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104675233 (IL6)
   05321 Inflammatory bowel disease
    104675233 (IL6)
   05332 Graft-versus-host disease
    104675233 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104675233 (IL6)
   05020 Prion disease
    104675233 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    104675233 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104675233 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104675233 (IL6)
   04931 Insulin resistance
    104675233 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104675233 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104675233 (IL6)
   05135 Yersinia infection
    104675233 (IL6)
   05133 Pertussis
    104675233 (IL6)
   05134 Legionellosis
    104675233 (IL6)
   05152 Tuberculosis
    104675233 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104675233 (IL6)
   05161 Hepatitis B
    104675233 (IL6)
   05171 Coronavirus disease - COVID-19
    104675233 (IL6)
   05164 Influenza A
    104675233 (IL6)
   05162 Measles
    104675233 (IL6)
   05168 Herpes simplex virus 1 infection
    104675233 (IL6)
   05163 Human cytomegalovirus infection
    104675233 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675233 (IL6)
   05169 Epstein-Barr virus infection
    104675233 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104675233 (IL6)
   05144 Malaria
    104675233 (IL6)
   05142 Chagas disease
    104675233 (IL6)
   05143 African trypanosomiasis
    104675233 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675233 (IL6)
   01523 Antifolate resistance
    104675233 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675233 (IL6)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104675233 (IL6)
SSDB
Motif
Pfam: IL6
Other DBs
NCBI-GeneID: 104675233
NCBI-ProteinID: XP_010378012
LinkDB
Position
6
AA seq 252 aa
MNSVSTSKCRKSLALERPAAVEPCVREGCVAQRGLAGGQQQRQAPSCAVSSRRRSLPSGT
GAFGPVAFSLGLLLVLPAAFPAPVLLGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISA
LRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL
EYLQNRFESSEEQARAVQMSTKVLIQFLQKKVSVSSFPHLGVGEDRLKDSVLDNSGMQCH
FQKRRLHVNKKV
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagtaagtgcaggaaatccctagccctggaacggccagcggcg
gtcgagccctgtgtgagggagggatgtgtggcccagcgagggctggcgggcggccagcag
cagaggcaggctcccagctgtgctgtcagctcacgccgccgctcgctcccctccggcaca
ggcgccttcggtccagttgccttctccctggggctgctcctggtgttgcctgctgccttc
cctgccccagtactcctaggagaagattccaaagatgtagccgccccacacagccagcca
ctgacctcttcagaacgaattgacaaacacattcggtacatcctcgacggcatctcagcc
ctgagaaaggagacatgtaacaggagtaacatgtgtgaaagcagcaaagaggcactggca
gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc
aatgaggagacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta
gagtacctccagaacaggtttgagagcagtgaggaacaagccagagctgtgcagatgagt
acaaaagtcctgatccagttcctgcagaaaaaggtgagtgtgtcctccttccctcacctt
ggtgtgggggaagacaggctcaaagacagtgtcctggacaactcagggatgcaatgccac
ttccaaaagagaaggctacatgtaaacaaaaaagtctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676155
Entry
104676155         CDS       T03989                                 

Gene name
IFNL1
Definition
(RefSeq) interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104676155 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104676155 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104676155 (IFNL1)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104676155 (IFNL1)
SSDB
Motif
Pfam: IL28A YwiC
Other DBs
NCBI-GeneID: 104676155
NCBI-ProteinID: XP_010379221
UniProt: A0A2K6RQ79
LinkDB
Position
12
AA seq 202 aa
MAAAWIVVLVPLVLGLAVAGPVPTSKPTTTGKGCDIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPRNWDLRLLQVRERPVALEAELALSLKVLEAAADTDSALGVVLDQPL
HTLHHILSQLRACIQAQPTAGPSPRGRLQHWLHRLQEAPKKESPGCLEASVTFNLFRLLI
RDLICVANGDLCLRTSTHPEST
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgcagcttggatcgtggtgctggtgcctttggtgctaggcttggccgtggcaggc
cctgtccccacttcaaagcccaccacaactgggaagggctgcgacattggcaggttcaaa
tctctgtcaccgcaggagttggcaagcttcaagaaggccagggacgccttggaagaatca
ctcaagttgaaaaactggagttgcagctctcctgtcttccccaggaattgggacctaagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgtcgctgaaa
gtcctggaggctgccgctgacactgactcggccctgggggtcgtcctagaccagcccctt
cacaccctgcaccacatcctttctcagctccgggcctgtatccaggctcaacccacagca
gggcccagtccccggggccgcctccaacactggctacaccggctccaggaggcccccaaa
aaggagtcccctggctgcctcgaggcgtctgtcaccttcaacctcttccgcctactcata
cgagacctgatatgtgtcgccaatggggacctgtgtctgagaacgtcaacccaccccgaa
tccacctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676156
Entry
104676156         CDS       T03989                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104676156
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104676156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104676156
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104676156
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 104676156
NCBI-ProteinID: XP_010379222
UniProt: A0A2K6NYB2
LinkDB
Position
12
AA seq 200 aa
MKLDMTGGCMPVLVLMAAVLTVTGAVPVTRLRGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCKCHSRLLPRTWDLRQLQVRERPVALEAELALTLKVLEAAADADSALV
DVLDQPLHTLHHILSQLRACIQPQPTAGPRPRGRLHHWLHRLQEAPEKESPGCLEASVTF
NLFRLLTRDLKCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgaccgggggctgcatgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcaccaggctccgcggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaagtgccactcccgcctcctc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccgtggctttggaggct
gagctggccctgacgctgaaggttctggaggctgccgcagatgctgactcggccctggtg
gatgtcttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgt
atccagcctcagccgacggcagggcccaggccccggggccgcctccaccactggctgcac
cggctccaggaggccccagaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgggacctgaaatgtgtggccagcggggacctgtgtgtt
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676158
Entry
104676158         CDS       T03989                                 

Definition
(RefSeq) interferon lambda-3
  KO
K22669  interferon lambda 2/3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104676158
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104676158
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104676158
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104676158
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 104676158
NCBI-ProteinID: XP_030768907
LinkDB
Position
12
AA seq 200 aa
MKLDMAGGCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEAAADADSALV
DVLDQPLHTLHHILSQLRACIQPQPTAGPRPRGRLHHWLHRLQEAPEKESPGCLEASVTF
NLFRLLTRDLKCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatggccgggggctgcatgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcggttcctgtcgccaggctccgcggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtctcttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccgtggctttggaggct
gagctggccctgacgctgaaggttctggaggccgccgctgatgctgactcggccctggtg
gatgtcttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgt
atccagcctcagccgacggcagggcccaggccccggggccgcctccaccactggctgcac
cggctccaggaggccccagaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgggacctgaaatgtgtggccagcggggacctgtgtgtt
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679003
Entry
104679003         CDS       T03989                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04622  RIG-I-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104679003 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104679003 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    104679003 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104679003 (IFNK)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104679003 (IFNK)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104679003
NCBI-ProteinID: XP_010382754
LinkDB
Position
16
AA seq 201 aa
MIQKCLWLQFLMGMFIAGTLSLDCNLLNVHLRRVTWQNLRLLSSMSNSFPVECLRENIAF
ELPQEFLQYTQHMKRDIKKAFYEISLQTFNIFSQHTFKSWKERHVKQIQIGLDQQAEYLN
QCLEEDKNENEDMKEMKENEMKPSEARVPQLSNLELRRYFNRIDNFLKEKKYSDCAWEIV
RVEIRRCLYYFYKFTALFRRK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgattcaaaagtgtctgtggcttcagttccttatgggtatgttcattgctggcacccta
tccctggactgtaacttactgaatgttcacctgagaagagtcacctggcaaaatctgaga
cttctgagtagtatgagcaattcatttcctgtagaatgtctacgagaaaacatagctttt
gagttgccccaagagtttctacaatacacccagcatatgaagagggacatcaagaaggcc
ttctatgaaatatccctacagaccttcaacatcttcagccaacacaccttcaaatcttgg
aaagagagacacgtcaaacaaatccaaataggacttgatcagcaagcagagtacctgaac
caatgcttggaggaagacaagaatgaaaatgaagacatgaaagaaatgaaagagaatgag
atgaaaccctcagaagccagggtcccccagctgagtaacctcgaactgaggagatatttc
aacaggatagacaatttcctgaaagaaaagaaatacagtgactgtgcctgggagattgtc
cgagtggaaatcagaagatgtttgtactacttttacaaattcacagctctattcaggagg
aaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680728
Entry
104680728         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-10
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680728
   04151 PI3K-Akt signaling pathway
    104680728
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680728
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104680728
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104680728
   04621 NOD-like receptor signaling pathway
    104680728
   04622 RIG-I-like receptor signaling pathway
    104680728
   04623 Cytosolic DNA-sensing pathway
    104680728
   04650 Natural killer cell mediated cytotoxicity
    104680728
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680728
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104680728
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104680728
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104680728
   05161 Hepatitis B
    104680728
   05160 Hepatitis C
    104680728
   05171 Coronavirus disease - COVID-19
    104680728
   05164 Influenza A
    104680728
   05162 Measles
    104680728
   05168 Herpes simplex virus 1 infection
    104680728
   05163 Human cytomegalovirus infection
    104680728
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680728
   05169 Epstein-Barr virus infection
    104680728
   05165 Human papillomavirus infection
    104680728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104680728
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   104680728
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104680728
NCBI-ProteinID: XP_010385100
LinkDB
Position
16
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSTELYQQLNDLE
ACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSRCAWEVVRAEIMRSLSFSTN
LQKRLRKKN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacacagcctcctagaaaaattttccacggaactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggccggggtaggagagactccactgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
cgttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaagaagaattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115893964
Entry
115893964         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-4
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    115893964
   04151 PI3K-Akt signaling pathway
    115893964
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115893964
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    115893964
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    115893964
   04621 NOD-like receptor signaling pathway
    115893964
   04622 RIG-I-like receptor signaling pathway
    115893964
   04623 Cytosolic DNA-sensing pathway
    115893964
   04650 Natural killer cell mediated cytotoxicity
    115893964
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115893964
  09163 Immune disease
   05320 Autoimmune thyroid disease
    115893964
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    115893964
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115893964
   05161 Hepatitis B
    115893964
   05160 Hepatitis C
    115893964
   05171 Coronavirus disease - COVID-19
    115893964
   05164 Influenza A
    115893964
   05162 Measles
    115893964
   05168 Herpes simplex virus 1 infection
    115893964
   05163 Human cytomegalovirus infection
    115893964
   05167 Kaposi sarcoma-associated herpesvirus infection
    115893964
   05169 Epstein-Barr virus infection
    115893964
   05165 Human papillomavirus infection
    115893964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    115893964
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   115893964
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 115893964
NCBI-ProteinID: XP_030775817
LinkDB
Position
16
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLNDLE
ACVTQEVGLEEILLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEVMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttaatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaatctcctagaaaaattttccacggaactttaccagcaactgaatgacctggaa
gcctgcgtgacacaggaggttggattggaagagattctgctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115893973
Entry
115893973         CDS       T03989                                 

Definition
(RefSeq) interferon alpha-10-like
  KO
K05414  interferon alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04623  Cytosolic DNA-sensing pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    115893973
   04151 PI3K-Akt signaling pathway
    115893973
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115893973
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    115893973
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    115893973
   04621 NOD-like receptor signaling pathway
    115893973
   04622 RIG-I-like receptor signaling pathway
    115893973
   04623 Cytosolic DNA-sensing pathway
    115893973
   04650 Natural killer cell mediated cytotoxicity
    115893973
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115893973
  09163 Immune disease
   05320 Autoimmune thyroid disease
    115893973
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    115893973
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115893973
   05161 Hepatitis B
    115893973
   05160 Hepatitis C
    115893973
   05171 Coronavirus disease - COVID-19
    115893973
   05164 Influenza A
    115893973
   05162 Measles
    115893973
   05168 Herpes simplex virus 1 infection
    115893973
   05163 Human cytomegalovirus infection
    115893973
   05167 Kaposi sarcoma-associated herpesvirus infection
    115893973
   05169 Epstein-Barr virus infection
    115893973
   05165 Human papillomavirus infection
    115893973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    115893973
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interferons
   115893973
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 115893973
NCBI-ProteinID: XP_030775885
LinkDB
Position
16
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLNDLK
ACVIAEPGIEETPLMNEDSILAVKKYFQRITLYLMEKKYSRCAWEVVRAEIMRSLSFSTN
LQKRLRKKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaatctcctagaaaaattttccacggaactttaccagcaactgaatgaccttaaa
gcctgtgtgatagcagagcctgggatagaagagactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
cgttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaagaaggattga

DBGET integrated database retrieval system