KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658667
Entry
104658667         CDS       T03989                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04625  C-type lectin receptor signaling pathway
rro04919  Thyroid hormone signaling pathway
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104658667 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104658667 (MDM2)
   04151 PI3K-Akt signaling pathway
    104658667 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104658667 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    104658667 (MDM2)
   04115 p53 signaling pathway
    104658667 (MDM2)
   04218 Cellular senescence
    104658667 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104658667 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104658667 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658667 (MDM2)
   05202 Transcriptional misregulation in cancer
    104658667 (MDM2)
   05206 MicroRNAs in cancer
    104658667 (MDM2)
   05205 Proteoglycans in cancer
    104658667 (MDM2)
   05203 Viral carcinogenesis
    104658667 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    104658667 (MDM2)
   05220 Chronic myeloid leukemia
    104658667 (MDM2)
   05218 Melanoma
    104658667 (MDM2)
   05219 Bladder cancer
    104658667 (MDM2)
   05215 Prostate cancer
    104658667 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104658667 (MDM2)
   05169 Epstein-Barr virus infection
    104658667 (MDM2)
   05165 Human papillomavirus infection
    104658667 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104658667 (MDM2)
   01522 Endocrine resistance
    104658667 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104658667 (MDM2)
   04121 Ubiquitin system [BR:rro04121]
    104658667 (MDM2)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104658667 (MDM2)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104658667 (MDM2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    104658667 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 104658667
NCBI-ProteinID: XP_010357050
UniProt: A0A2K6RWJ5
LinkDB
Position
10
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcagatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttctgaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacagaaacttggtagtagtcaatcagcaggaa
tcatcagactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtgcaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcgattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaagcccaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatccccct
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccaaagagtcgtgt
gttgaggaaaatgatgataaaatcacacaagcctcacaatcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagagaagaaacccaagacaaagaagaaagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcagggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtgtgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system