KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658789
Entry
104658789         CDS       T03989                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104658789 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104658789 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104658789 (SOCS6)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104658789 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 104658789
NCBI-ProteinID: XP_030781949
LinkDB
Position
21
AA seq 535 aa
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKPKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQN
ETACQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSC
CLDSSSPMEVSAVPPPGGGRAFPEDESQVDQDLLVAPEIFVDQSVNGLLIGTTGVVLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttgtttggtagctgctatggtaaagatatggccagctgcgatatcaatggtgaagat
gaaaaaggcggaaaaaacagatcgaaaagcgagagcctgatgggtacgctcaaaaggcgg
ctttctgcaaaacagaagccaaaaggcaaggcgggcacaccctctgggagctctgccgat
gaggacaccttctcctcctcctcagcacccatagtctttaaagacgtgagagctcagagg
ccgataaggtccacctcgctccgcagccatcactacagtcccacgccatggcctctgcgg
cccacgaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagcccagccctgaatggtgtccggaaggatttccacgacctccagaac
gagaccgcgtgccaagagcaagccaattcactgaagagctcggcctctcataacggagac
ctgcatctccacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacggagctgt
tgtctggacagctcttctcccatggaagtctctgccgttccccctccagggggagggcgc
gctttccccgaagatgagagtcaggtagaccaggacctgcttgtcgccccagagatcttc
gtggatcagtccgtgaatggcttgttgattggcaccacgggagtcgtgttgcagagcccg
agagcgggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgttgtcatttgaattttgatccgaactctgctcctggggttgcaagagtttatgactca
gtgcaaagtagtggtcccatggtcgtgacaagccttacagaggagctgaaaaaacttgca
aaacaaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttatcttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaacggtaggttt
agcttttatgaacagcccgatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattacttacaggagaagcactactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663176
Entry
104663176         CDS       T03989                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104663176 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104663176 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104663176 (SOCS5)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104663176 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 104663176
NCBI-ProteinID: XP_010362603
UniProt: A0A2K6NF71
LinkDB
Position
17
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVREKNISIGDSTPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtttgtctgtc
agagagaaaaacatcagcataggagactcaactcctcagcaacaaagtagtcccttaaga
gaaaatgttgccttgcaactgggattaagcccttcaaagaattcttcaaggagaaatcaa
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccgggaacaagacttgcacgaagagattcatactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataaa
aagtttgggagaactcgaagtggacttcaaaggagggagaggcgctacggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctgagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctgtctgaattaatgcttgagaaatgcccattt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcgcaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgcctcgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagtttcgat
gcccatgacccctgtgtatttcactcctccactgtaacaggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttt
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667710
Entry
104667710         CDS       T03989                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04380  Osteoclast differentiation
rro04630  JAK-STAT signaling pathway
rro04910  Insulin signaling pathway
rro04917  Prolactin signaling pathway
rro04930  Type II diabetes mellitus
rro04935  Growth hormone synthesis, secretion and action
rro05145  Toxoplasmosis
rro05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104667710 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104667710 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104667710 (SOCS1)
   04917 Prolactin signaling pathway
    104667710 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    104667710 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104667710 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104667710 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104667710 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104667710 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104667710 (SOCS1)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104667710 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 104667710
NCBI-ProteinID: XP_030781387
LinkDB
Position
20
AA seq 215 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPVPAPAPAPGDTHFR
TFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctctacagcagcagagccccga
cggcggccagagccttcctcctcttcctcctcctcgcccgctgcccccgcgcgcccgcga
ccgtgcccggcggtcccggtcccggccccggcccccgcccccggcgacacgcacttccgc
acgttccgttcgcacgccgattaccggcgcatcacgcgcgctagcgcgctcctcgacgcc
tgcggcttctactggggacccctgagcgtgcacggagcacacgagcggctgcgcgccgag
cccgtgggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgccctcagc
gtgaagatggcctcgggccccacgagcatccgcgtgcacttccaggccggccgcttccac
ctggacggcagccgcgagagcttcgactgcctcttcgaattgctggagcactacgtggcg
gcgccgcgtcgcatgctggggaccccgctgcgccagcgccgcgtgcggccgctgcaggag
ctgtgccgccagcgcatcgtggccaccgtgggccgcgagaacctggcgcgcatccccctc
aaccccgtcctccgcgactacttgagctccttccccttccagatctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669147
Entry
104669147         CDS       T03989                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04910  Insulin signaling pathway
rro04917  Prolactin signaling pathway
rro04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104669147 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104669147 (SOCS4)
   04917 Prolactin signaling pathway
    104669147 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104669147 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104669147 (SOCS4)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104669147 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 104669147
NCBI-ProteinID: XP_010370342
UniProt: A0A2K6NHU7
LinkDB
Position
5
AA seq 439 aa
MAENNENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNRERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKLRN
MEENINCFSHTNVQPCVITTDNALCREDPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELDDEILQLETPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLE
GKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLL
EHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKE
YHYKSKVRVLRIDAPEQQC
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaataatagtaaaaatgtagatgtaaggcccaagactagtcgg
agcagaagtgccgacagaaaagatggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgaaacagtaaatggtatagagaaaactgaagtg
tctttaaggaaccgagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaactaagaaat
atggaagaaaatataaactgtttctcacatactaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaagatcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggaattggatgatgaaatcctgcagctggaaaca
cctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcagatc
aataacaacccatgttactggggagtaatggataaatatgcagccgaagcactactggaa
ggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattctct
gttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcacaac
tttagctttgatgcacatgacccctgtgtcttccattctcctgacattactgggctccta
gaacattataaggacccaagcgcctgtatgttctttgaaccactgctgtccactccttta
attcggactttccccttttccctgcagcatatatgcagaacagttatttgtaactgtaca
acttatgatggcattgatgcccttccaattccttcttctatgaaattatatctgaaggaa
tatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674880
Entry
104674880         CDS       T03989                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X2
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104674880 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104674880 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104674880 (SOCS7)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104674880 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 104674880
NCBI-ProteinID: XP_010377656
UniProt: A0A2K6QAJ8
LinkDB
Position
19
AA seq 649 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPPPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAVAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLS
RGEQQQQQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDG
TGKRPSGELAASAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVD
VDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHA
PDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEM
KLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVV
EFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRI
DHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggatggcgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctccttggctatggagaggcggcccccgagccaggcccgccgccgccgccc
ccgggccatggccccccgccgccacccttccttgcgcggcccggcccgcggggctcccgg
ccgccgcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggag
gcggccccggagccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggac
cccaaggccctgccgccgggcttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggcggctctggggctcgggcagccggcagggccgggggtcaagacagtc
ggtgggggttgctgcccgtgcccgtgtccccctcagccgccccctccgcagccccagccg
cctgctgtcgccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctagtc
ctggagggcttggaatcggaggccgagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggc
cctgaattacctccggtgcccttcccgctgcaggacttggtccctctggggcgcttgagt
agaggggagcagcagcagcagcagcagcagcagcagcagcagcaacctcccccgcctccg
cctcctcccgggcccctccggccactcgcgggtccttctcggaagggctccttcaaaatc
cgcctcagtcgcctctttcgcaccaagagctgcaacggtggctccggcggtggggatggg
accggcaagaggccttctggagagctggctgcttcagctgcgagcctaacagacatggga
ggttctgcgggccgggagctggacgcagggaggaaacccaggttgacaagaactcaaagt
gccttttctccagtctccttcagccccctgttcacaggtgaaactgtgtcgcttgtggat
gtggacatttctcagcggggcctgacctctccacaccctccaactccccctcctcctcca
agaagaagcctcagcctcctagatgatatcagtgggacgctgcctacatctgtccttgtg
gctccgatggggtcttccttgcagtctttccccctacctccgcctcctccaccccatgcc
ccagatgcatttccccggattgctcccatccgagcagctgaatccctgcacagccaaccc
ccacagcacctccagtgtcctctctatcggcctgactcgagcagctttgcagccagcctt
cgagagttggagaagtgtggttggtattgggggccaatgaattgggaagatgcagagatg
aagctgaaagggaaaccagatggttctttcctggtacgagacagttctgatcctcgttac
atcctgagcctcagtttccgatcgcagggtatcacccaccacactagaatggagcactac
agaggaaccttcagcctgtggtgtcatcctaagtttgaggaccgctgtcaatctgttgta
gagtttattaagagagccattatgcactccaagaatggaaagtttctctatttcttaaga
tccagggttccaggattgccaccaactcctgtccagctgctctatccagtgtcccgattc
agcaatgtcaaatccctccagcacctttgcagattccggatacgacagctcgtcaggata
gatcacatcccagatctcccactgcctaaacctctgatctcttatatccgaaagttctac
tactatgatcctcaggaagaggtatacctgtctctaaaggaagcgcagctcatttccaaa
cagaagcaagaggtggaaccctccacgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677022
Entry
104677022         CDS       T03989                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04380  Osteoclast differentiation
rro04630  JAK-STAT signaling pathway
rro04668  TNF signaling pathway
rro04910  Insulin signaling pathway
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04935  Growth hormone synthesis, secretion and action
rro05160  Hepatitis C
rro05164  Influenza A
rro05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104677022 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104677022 (SOCS3)
   04668 TNF signaling pathway
    104677022 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104677022 (SOCS3)
   04920 Adipocytokine signaling pathway
    104677022 (SOCS3)
   04917 Prolactin signaling pathway
    104677022 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    104677022 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104677022 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104677022 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    104677022 (SOCS3)
   04931 Insulin resistance
    104677022 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104677022 (SOCS3)
   05164 Influenza A
    104677022 (SOCS3)
   05168 Herpes simplex virus 1 infection
    104677022 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104677022 (SOCS3)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104677022 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 104677022
NCBI-ProteinID: XP_010380220
UniProt: A0A2K6NNV0
LinkDB
Position
19
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSTEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgccggcacctttctgattcgcgacagctcggaccagcgccactttttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagccggttccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctccaccgaggtgcccgagcagccgtctgcccagccactccctggaagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678596
Entry
104678596         CDS       T03989                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
rro04910  Insulin signaling pathway
rro04917  Prolactin signaling pathway
rro04930  Type II diabetes mellitus
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104678596 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104678596 (SOCS2)
   04917 Prolactin signaling pathway
    104678596 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    104678596 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104678596 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104678596 (SOCS2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     104678596 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 104678596
NCBI-ProteinID: XP_010382229
UniProt: A0A2K6RSG0
LinkDB
Position
10
AA seq 198 aa
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTNPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcggagaagggacgcggagccagtgg
gggaccgcagggtcggcggaggagccatccccggaggcggcgcgtctggcgaaggccctg
cgggagctgggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacgtcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacagggcca
gaagccccccggaacggcaccgttcacctttatctgaccaacccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtacaggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

DBGET integrated database retrieval system