KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658857
Entry
104658857         CDS       T03989                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104658857 (PDGFRA)
   04014 Ras signaling pathway
    104658857 (PDGFRA)
   04015 Rap1 signaling pathway
    104658857 (PDGFRA)
   04630 JAK-STAT signaling pathway
    104658857 (PDGFRA)
   04020 Calcium signaling pathway
    104658857 (PDGFRA)
   04072 Phospholipase D signaling pathway
    104658857 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    104658857 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104658857 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104658857 (PDGFRA)
   04540 Gap junction
    104658857 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104658857 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658857 (PDGFRA)
   05206 MicroRNAs in cancer
    104658857 (PDGFRA)
   05230 Central carbon metabolism in cancer
    104658857 (PDGFRA)
   05231 Choline metabolism in cancer
    104658857 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    104658857 (PDGFRA)
   05218 Melanoma
    104658857 (PDGFRA)
   05215 Prostate cancer
    104658857 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104658857 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104658857 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104658857 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rro04090]
    104658857 (PDGFRA)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104658857 (PDGFRA)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104658857 (PDGFRA)
CD molecules [BR:rro04090]
 Proteins
  104658857 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 104658857
NCBI-ProteinID: XP_010357288
UniProt: A0A2K6QIB8
LinkDB
Position
2
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGDSEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccagcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcgttaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggatagtgaagtgagctggcagtacccc
atgtctgaagaagagaactctgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacagtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcattgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcccgagactcctgtaact
ttacacaacagcgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagagagtcactatttctgttcatgagaaagggttcattgaaatcaaacccacc
tttagccagctggaagctgtcaacctgcatgaagtcaaacattttgtcgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgatcgaaaatctc
acggagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
cttatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccttgtgacttttgccaaagtggaagagaccattgcggtgaga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcatttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacataatcacggagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccagagaag
ccaaagaaagagctggatatctttgggttgaaccctgctgatgacagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctgtatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtatcgaaaggcagcacctttctgcctgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggtactccttaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctatgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctctttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcatctggatttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagcggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system