KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658903
Entry
104658903         CDS       T03989                                 

Gene name
ERBB4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 isoform X1
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04151  PI3K-Akt signaling pathway
rro05014  Amyotrophic lateral sclerosis
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104658903 (ERBB4)
   04012 ErbB signaling pathway
    104658903 (ERBB4)
   04020 Calcium signaling pathway
    104658903 (ERBB4)
   04151 PI3K-Akt signaling pathway
    104658903 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104658903 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104658903 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104658903 (ERBB4)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104658903 (ERBB4)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   104658903 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH DUF3951
Other DBs
NCBI-GeneID: 104658903
NCBI-ProteinID: XP_030772770
LinkDB
Position
14
AA seq 1308 aa
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASNGPPKAED
EYVNEPLYLNTFANALGKAEYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggcggcggggaccgtc
caacccagcgattctcagtcagtgtgtgcaggaacggagaataaactgagctctctctct
gacctggaacaacagtaccgagccttgcgcaagtactatgaaaactgtgaagttgtcatg
ggcaacctagagataaccagcattgagcacaaccgagacctctccttcctgcggtctgtt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtggaacgaaactttatgaggatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattgaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcggacact
attcattggcaagatattgttcggaacccatggccttccaacttgactcttgtgtcaaca
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acggaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacgggccttacgtcagtgactgctgccatcgagaatgtgctggaggctgctcagga
cctaaggacacagactgctttgcctgcatgaatttcaatgacagtggagcgtgtgttact
cagtgtccccaaacctttgtctacaatccaaccacttttcaactggagcacaatttcaat
gcaaagtacacatatggagcattctgtgtcaagaaatgtccacataactttgtggtagat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatttgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcaaactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttctagtcactggtattcacggggacccttacaatgca
attgaagccatagacccagagaaactgaatgtctttcggacagtcagagagataacaggt
ttcctgaacatacagtcatggccaccaaacatgactgatttcagtgttttttctaaccta
gtgaccattggtggaagagtactctatagtggcctctccttgcttatcctcaagcaacag
ggcatcacctctctacagttccagtccctgaaggaaatcagcgcaggaaacatctatatc
actgacaacagcaacttgtgttattatcataccattaactggacaacactcttcagcaca
atcaaccaaagaatagtaatccgggacaatagaaaagctgaaaactgtactgctgaagga
atggtgtgcaaccatctgtgttccagtgatggctgttggggacctgggccagaccaatgt
ctatcgtgtcgccgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgat
ggtgaatttcgggaatttgagaacggctccatctgtgtggagtgtgaccctcagtgtgag
aagatggaagatggtctcctcacatgtcatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccagatcgggagtgccatccatgccatccaaac
tgcacccaagggtgtaatggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcagctggagtaattggtggg
ctcttcattctggtcattgttggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtggaacctttaactccc
agtggcacagcacccaatcaagctcaacttcgtattttgaaagaaactgagttgaagagg
gtaaaagtccttggctcaggtgcttttggaacagtttataaaggcatttgggtacctgaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gtccggttgttgggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccc
catggctgcctgttggagtatgtccacgagcacaaggataacattggatcacaactgcta
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacggctcgtt
catcgggatttggcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaattaca
gattttggactagccagactcttggaaggagatgaaaaagaatacaatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaacgcgagaaatccctgatttattagagaaaggagaacgtttgcct
cagcctcccatctgcacaattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaggatttggaagatatgatggatgctgag
gagtacttggtccctcaggctttcaacatcccacctcccatctatacttccagagcaaga
attgactcgaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaatcagtttgtataccgagatggaggttttgctgcagaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgttgcacagggtgctacagctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcacccagaggtacagcgctgaccccaccgtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgactcctatgcgagacaaacccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcggagaaaaaatggagacctt
caggcattggataatcccgaatatcacagtgcatccaatggtccacccaaggccgaggat
gagtatgtgaatgagccgctgtacctcaacacctttgccaacgccttgggaaaagctgag
tacctgaagaacaatgtactgtctgtgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatccggaatacctctctgagttctccctgaagccaggcactgtgctgccgcctccacct
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system