KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658948
Entry
104658948         CDS       T03989                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04114  Oocyte meiosis
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104658948 (ITPR3)
   04020 Calcium signaling pathway
    104658948 (ITPR3)
   04070 Phosphatidylinositol signaling system
    104658948 (ITPR3)
   04022 cGMP-PKG signaling pathway
    104658948 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104658948 (ITPR3)
   04210 Apoptosis
    104658948 (ITPR3)
   04218 Cellular senescence
    104658948 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104658948 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104658948 (ITPR3)
   04621 NOD-like receptor signaling pathway
    104658948 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    104658948 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    104658948 (ITPR3)
   04922 Glucagon signaling pathway
    104658948 (ITPR3)
   04929 GnRH secretion
    104658948 (ITPR3)
   04912 GnRH signaling pathway
    104658948 (ITPR3)
   04915 Estrogen signaling pathway
    104658948 (ITPR3)
   04921 Oxytocin signaling pathway
    104658948 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    104658948 (ITPR3)
   04918 Thyroid hormone synthesis
    104658948 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    104658948 (ITPR3)
   04924 Renin secretion
    104658948 (ITPR3)
   04925 Aldosterone synthesis and secretion
    104658948 (ITPR3)
   04927 Cortisol synthesis and secretion
    104658948 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104658948 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    104658948 (ITPR3)
   04971 Gastric acid secretion
    104658948 (ITPR3)
   04972 Pancreatic secretion
    104658948 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104658948 (ITPR3)
   04725 Cholinergic synapse
    104658948 (ITPR3)
   04728 Dopaminergic synapse
    104658948 (ITPR3)
   04726 Serotonergic synapse
    104658948 (ITPR3)
   04720 Long-term potentiation
    104658948 (ITPR3)
   04730 Long-term depression
    104658948 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    104658948 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    104658948 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    104658948 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104658948 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104658948 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104658948 (ITPR3)
   05012 Parkinson disease
    104658948 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    104658948 (ITPR3)
   05017 Spinocerebellar ataxia
    104658948 (ITPR3)
   05020 Prion disease
    104658948 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    104658948 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104658948 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104658948 (ITPR3)
   05163 Human cytomegalovirus infection
    104658948 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104658948 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104658948 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104658948 (ITPR3)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104658948 (ITPR3)
Ion channels [BR:rro04040]
 Ligand-gated channels
  IP3 receptor
   104658948 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 104658948
NCBI-ProteinID: XP_010357411
UniProt: A0A2K6R3W2
LinkDB
Position
4
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKATGMGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSDEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKTSLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPMGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
NEMGMSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLIIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPSNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDGELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagcct
gcggccggggacctggacaaccctcctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgctgatgtggtattgctgcagaagctgcagcacgcggcccagatggag
cagaagcaaaacgacacggagaacaagaaggtgcacggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacggtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgaccctggatgccacaggcaatgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaatggggacaacgtggtcgtgggg
gataaggtgatcctgaatcctgtcaacgctgggcagcctctgcatgccagcaattacgaa
ctcagcgataatgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagttccgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggttgttccatgcggagcaggagaagttcctgacctgtgatgagtacaagggcaag
ctgcaggtgttcctgagaaccacactgcgccagtcggccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggccacgggcaactacctggccgctgaggagaac
cccagttacaaaggtgatgcctcggatcccaaggcaacaggaatgggggcccagggccgt
gcaggccgcaggaatgctggggagaagatcaagtatcgcctggtggccgtgcctcatggc
aacgacattgcctctctctttgagctggaccccaccaccttacagaaaaccgactctttc
gtgccccggaactcatacgtccggctgcggcacctctgcaccaacacatggatccagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccactaaggaagacaaggaggcctttgccatcgtgtcggtgcctgtgtccgagatccga
gacctggactttgccaatgatgccagctccatgctggccagcgccgtagagaaactcaat
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagtgatgtccccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacagatctttggc
attctgaaggccccattccgtgagaaggggggtgaaggtcccctggtacggctggaggag
ctgtcagaccagaagaacgccccctatcagcacatgttccgtctgtgttaccgcgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagtttgggatg
atgcagtcccagattggctatgacatcttggctgaggacaccatcaccgccctgctgcac
aacaatcgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacattgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatcaggaccgaacttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagacgaggaagtgtggctcacatggactgacaagaat
aacgagcaccatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaatgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgatgagatctcccagcagctgggtgtggacctgatt
ttcctgtgcatggcggacgagatgctgccctttgacctgcgcgcctctttctgccacctg
atgctgcacgtgcatgtggaccgcgacccccaggaactggtcacgcccgtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggctgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaacctcatctacttcggtttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggcggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtcagtcttcggtgcccccagc
ctgcctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatctcctatctgctgtctgtcttcaagaaggagttcgtggag
gtgtttcccatgcaggacagcggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgtatcggggagcaggcggaggccatgtttggagtggggaag
acaagcagcatgctggaggtggacgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgcttttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcagagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggcgaggaggtggag
gcaggcgcagccaaggacaagaaggagcggcccacggatgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagattgtcaagggcatcctggaaaggctgaac
aagatgtgcggggtcggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggtgatgccaag
atgatggagatcctacgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctgcacaagcacctgcaccttttcctcacaccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctctgagatcagcgag
cccgtgttgcagcacttcgtgcacctgctggccacgcatgggcgccatgtgcagtacctg
gacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgatgatgtggtcgtgttctacaacgataagaca
tcgctggcccacttgctggacatgatgaaggccgcccgtgatggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggctgcctgcgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcaccgaggtgaaaatggcctatgtgaactttgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagaacttcaccctggacatggcgcgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccctggagaagtatgtgttgagcgtcgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtccactacacggctcctcgagtgtccgtggctacagcagcagcataagggc
tctgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatctcgctg
cccatggacctggacgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtgcaggctgagctgtccgtgctggtggacgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
ggaggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgtatcaaggtgctgcggaccctgcagcagatgctgctcaagaaaaccaagtatggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccatgggcactggcctggacccagactggtcagca
atcgcagccacccagtgcaggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aaatcagagcgcttcttcaaggtgctgcatgaccgcatgaagcgggcccagcaggagacc
aagtccaccgtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgtgag
ccagtcgaccccaccaccaaaggccgcgtggcctccttttcgatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
aacgagatgggcatgtctgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgcgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaatgtgggcctcatcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacctgcattgtg
actcacgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaaactgctc
ctggctctgatggagagccggcatgacagtgaaaatgccgagcgcatcctcatcagcctg
cggccccaggagctggtggatgtcatcaagaaggcctacctgcaggaagaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccacaacatctacatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccagtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccagcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cctggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccactaccgag
caggacgagcagggcagcaaagtgagcgacttctttgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccctacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ctgctgttctggatcctcatctgcttctccattgcggccctgttcaccaagcgctacagc
attcgccccctcatcgtggcgctcatcctacgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagaccctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcatccttgaggtcgac
cgactgcccagcaaccactccacagccagccccctgggtatgccacatggagctgctgca
tttgtggacacctgcagtggggataagatggactgtgtctcggggctctcggtgcccgag
gtcctggaagaggatggggagctggacagcacagagcgggcctgtgacactctgctgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggtgtaggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcgcgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaagagattctcaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacggtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtcctggtccgcgtgaagaacaag
accgactacacaggccccgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaac
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacagagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcatgagccgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664252
Entry
104664252         CDS       T03989                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104664252 (ITPR1)
   04020 Calcium signaling pathway
    104664252 (ITPR1)
   04070 Phosphatidylinositol signaling system
    104664252 (ITPR1)
   04022 cGMP-PKG signaling pathway
    104664252 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104664252 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104664252 (ITPR1)
   04210 Apoptosis
    104664252 (ITPR1)
   04218 Cellular senescence
    104664252 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104664252 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104664252 (ITPR1)
   04621 NOD-like receptor signaling pathway
    104664252 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    104664252 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104664252 (ITPR1)
   04929 GnRH secretion
    104664252 (ITPR1)
   04912 GnRH signaling pathway
    104664252 (ITPR1)
   04915 Estrogen signaling pathway
    104664252 (ITPR1)
   04921 Oxytocin signaling pathway
    104664252 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    104664252 (ITPR1)
   04918 Thyroid hormone synthesis
    104664252 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    104664252 (ITPR1)
   04924 Renin secretion
    104664252 (ITPR1)
   04925 Aldosterone synthesis and secretion
    104664252 (ITPR1)
   04927 Cortisol synthesis and secretion
    104664252 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104664252 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    104664252 (ITPR1)
   04971 Gastric acid secretion
    104664252 (ITPR1)
   04972 Pancreatic secretion
    104664252 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104664252 (ITPR1)
   04725 Cholinergic synapse
    104664252 (ITPR1)
   04728 Dopaminergic synapse
    104664252 (ITPR1)
   04726 Serotonergic synapse
    104664252 (ITPR1)
   04720 Long-term potentiation
    104664252 (ITPR1)
   04730 Long-term depression
    104664252 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    104664252 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104664252 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104664252 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104664252 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104664252 (ITPR1)
   05012 Parkinson disease
    104664252 (ITPR1)
   05016 Huntington disease
    104664252 (ITPR1)
   05017 Spinocerebellar ataxia
    104664252 (ITPR1)
   05020 Prion disease
    104664252 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    104664252 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104664252 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104664252 (ITPR1)
   05163 Human cytomegalovirus infection
    104664252 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104664252 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104664252 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104664252 (ITPR1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104664252 (ITPR1)
Ion channels [BR:rro04040]
 Ligand-gated channels
  IP3 receptor
   104664252 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 104664252
NCBI-ProteinID: XP_010364019
LinkDB
Position
1
AA seq 2719 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGESALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPS
KPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIAL
LEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEV
DRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATAD
KTKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALIL
NDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQ
GEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAK
HTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLF
NEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSG
LLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMS
FVGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVI
KSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEF
LFSDVCRVESGENCSSPAPKEELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGD
VLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERN
LDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQ
RIGLLGHPPHMNVNPQQPA
NT seq 8160 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctgcatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccagaagcagttctggaaagctgctaagcctggggcc
aacagcacaacagatgcagtactgctcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcccgct
ctgttggagaagaacgccatgagagtaacattggatgaggctggaaatgaagggtcctgg
ttttacattcagccgttctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggttgttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaactccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgatgtggtg
aggctgttccatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
catgtcttcctgagaaccacgggccggcagtcggccacatctgccactagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccgtgtcggggcggagcagggtattggaac
agccttttccgtttcaagcacctggccacggggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtagaccctgatcaggatgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtgtactccctggtctctgtgcccgaa
ggcaatgacatctcctccatttttgagttagaccccaccactctccgtggaggcgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaggaagaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttcccgtttctcctgctgaagtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagctg
gagaagggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctggaagacttg
gtttactttgtcactggtggaactaattctggtcaagatgttcttgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatatcctcaagcagatcttc
aagttgttacaagccccattcacagactgcggtgatggcccaatgcttcgcctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggccgaagacactatcactgccctgctccac
aataatcggaaactcctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctctgtgtctcc
atgaacaagtcgattccagtgacccaggagctaatatgtaaagctgtactgaatcccacc
aatgctgacatcctgattgagaccaagttggttctttctcgttttgagtttgaaggcgtt
tcttccactggagagagtgctctggaggcaggagaagatgaggaagaggtgtggctgttt
tggagagacagcaacaaagagattcgtagcaagagtgtgagggagttggcgcaggacgct
aaagaagggcagaaggaagaccgagacgttctcagctactacagatatcaactgaacctc
tttgccaggatgtgtctggaccggcaatacctggccatcaatgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggcg
tccttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcggagattccctcggagattgccattgatgactat
gatagtagtggagcttccaaagatgaaattaaggagagattcgctcagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaggagaaa
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtgcat
gtgacgacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgaggtctattcatggcgtgggagagctg
atgacccaggtggtgctccggggaggaggctttttgcctatgactcccatggccgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatcatggtcatggacacc
aagctgaagatcattgagatactccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagaa
acatcctccggaaacagcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagaacaagcagaaggcatctttggaggaagcgaggagaacactccactg
gacttggacgatcacggcggcagaacctttctccgtgtcttgctccacctgacaatgcat
gactacccacccctggtgtccggggccctgcagctcctcttccgacactttagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtggac
aactacaaacagatcaaacaagacttggatcaactgagatccatcgtggaaaagtcagag
ctttgggtgtacaaagggcagggccctgatgaaaccatggatggtgcatctggcgaaaat
gaacataagaaaacggaggagggaaataacaagtcacaaaagcatgaaagcaccagcagc
tacaactacagagtggtcaaagagattttgattcggctcagcaaactctgtgttcaggag
agtgcctcggtgagaaagagcaggaagcagcagcagcgtctgctccggaacatgggcgcg
cacgccgtggtgctggagctgctgcagattccctatgagaaggccgaagataccaagatg
caagagataatgaggctggctcatgaatttttgcagaatttctgtgcaggcaaccagcag
aatcaagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggca
gtaaccatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaacgagaga
gtcgttcagcacttcgttcactgcatagagactcacggtcggaacgtccagtatataaag
ttcttacagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggtt
atggctgagctggtcaattcaggagaggatgtcctcgtgttctacaacgacagagcctct
ttccagactctgatccagatgatgcggtcagagcgggatcggatggatgagaacagccct
ctcatgtaccacatccacttggtcgagcttctggctgtgtgcacagagggtaagaatgtc
tacacagagatcaagtgcaactccctgctccctctggatgacatcgttcgcgtggtgacc
catgaggactgcatccctgaggttaaaatcgcatacattaacttcctgaatcactgctat
gtggacacagaggtggaaatgaaggagatttacaccagcaatcacatgtggaaattgttt
gagaatttccttgtagacatctgcagggcctgtaacaacactagtgacaggaaacatgca
gactccattttggagaagtacgtcaccgaaatcgtcatgagtattgttactactttcttc
agctctcccttctcagaccagagtacaactttacagactcgccagcctgtctttgtgcaa
ctgctgcaaggagtgttcagagtttaccactgcaactggttaatgccaagccaaaaagcc
tccgtggagagctgtattcgggtgctgtctgatgtagccaagagccgggccattgccatt
cccgtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcag
aaaacagccatgaactggcggctctcagcccgcaatgccgcacgcagggactctgttctg
gcagcttccagagactaccggaatatcattgagagattgcaggacatcgtctccgcgctg
gaggaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccac
agacccgagctgcttttcccagagaacacagatgccagaaggaaatgtgaaagtggcggt
ttcatttgcaagttaataaaacatacaaaacagctgctagaagaaaatgaggagaagctc
tgcattaaggtcctccagaccctgagggaaatgatgaccaaagatagaggctatggagaa
aagggtgaggcgctcaggcaaattctggtcaaccgttactatggaaacatcagaccttcg
ggaagaagagagagccttaccagctttggcaatggcccactgtcaccaggaggacccagc
aagcccgggggaggagggggaggttccggatccagctctatgagcaggggtgagatgagt
ctggccgaggttcagtgtcaccttgacaaggagggggcttccaatctagttatcgacctc
atcatgaatgcatccagtgaccgagtgttccatgaaagcattctcctggctattgccctt
ctggaaggaggcaacaccaccatccagcactcctttttctgccgcttgacagaagataag
aagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcacagcaagaaatc
aaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaagacgacgaggta
gacagggatgccccgtcacggaaaaaagctaaagagcccacaacacagataacagaagag
gtccgggatcagctcctggaggcctctgctgccaccaggaaagccttcaccactttcagg
agggaggctgatcccgacgaccactaccagcctggagagggcacccaggccactgccgac
aagaccaaggatgacctggagatgagcgcggtcatcaccatcatgcagcccatcctccgc
ttcctgcaactcctgtgcgaaaaccacaaccgagacctgcagaacttcctccgttgccaa
aataacaagaccaactacaatttggtatgtgagacgctgcagtttctggactgtatttgt
ggaagcacaactggaggccttggtcttctgggcttgtatataaatgaaaagaacgtagca
cttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggaccttgccatgagaac
cagaactgcatagccactcatgaatccaatggcattgacatcatcacagccctgatcctc
aatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaactgaagaacaat
gcctcgaagttactcctggccatcatggaaagcaggcacgacagtgaaaacgcagagagg
atactttataacatgaggccgaaggaactggtggaagtgatcaagaaagcctacatgcaa
ggtgaagtggaatttgaggatggagaaaacggtgaggatggagcggcgtcccccaggaac
gtggggcacaacatctacatattagctcatcagttggctcggcataacaaagaacttcag
agcatgctgaaacctggtggccaagtggacggagatgaagctctggagttttatgccaag
cacacggcgcagatagagattgtcagattagaccgaacaatggaacagatagtctttcct
gtgcccagcatatgtgaattcctaaccaaggagtcaaaactgcgaatttactatactaca
gagagagacgaacaaggcagcaaaatcaacgatttctttctgcggtctgaagacctcttc
aatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgc
aacatgtctttctggagcagcatttcgtttaacctggccgtcctgatgaacctgctcgtg
gcgtttttctacccatttaaaggagtccgaggaggaaccctggagccccactggtcgggc
ctcctgtggacagccatgctcatctctctggccatcgtcattgccctcccaaagccccat
ggcatccgggccttaattgcctccacaattctacgattgatattttcggtcgggttacaa
cccaccttgtttcttctgggcgctttcaatgtatgcaataaaatcatctttctaatgagc
tttgtgggcaactgtgggacgttcacaagaggctaccgagccatggttctggatgttgaa
ttcctctatcatttgttgtatctggtgatctgtgccatggggctctttgtccatgaattc
ttctacagtctgctgctttttgatttagtgtacagagaagagactttgcttaatgtcatt
aaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctggctctgatcctt
gtttacctgttctcaatagtgggctatcttttcttcaaggatgactttatcttggaagta
gataggctgcccaatgaaacagctgttccagaaaccggcgagagtttggcaagcgagttc
ctgttctctgatgtgtgtagggtggagagtggggagaactgctcctctcctgcacccaaa
gaagagctggtccctgcagaagaaacggaacaggataaagagcacacatgtgagacgctg
ctgatgtgcattgtcactgtactgagtcacgggctccggagcgggggtggagtaggagat
gtgctcaggaagccgtccaaagaggaacccctgtttgctgctagagtgatttatgacctc
ctgttcttcttcatggttatcatcattgttcttaacctgatttttggggttatcattgac
acttttgctgacctgaggagtgagaagcagaagaaggaagagatcttgaagaccacgtgc
tttatctgtggcttggaaagagacaagtttgacaacaagactgttacctttgaagaacac
atcaaggaagaacacaacatgtggcactacctgtgcttcatcgtcctggtgaaagtgaag
gattccaccgaatatactgggcccgagagttatgtggcagaaatgatcaaggaaagaaac
cttgactggttccccaggatgagagccatgtcattggtcagcagtgattctgaaggagaa
cagaatgagctgaggaacctgcaggagaagctggagtccaccatgaaacttgtcacgaac
ctttctggccagctgtcagaattaaaggatcagatgacagaacaaaggaagcagaaacaa
agaattggtcttctaggacatcctcctcacatgaatgtcaacccacaacaaccagcataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675331
Entry
104675331         CDS       T03989                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04114  Oocyte meiosis
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04611  Platelet activation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04728  Dopaminergic synapse
rro04730  Long-term depression
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104675331 (ITPR2)
   04020 Calcium signaling pathway
    104675331 (ITPR2)
   04070 Phosphatidylinositol signaling system
    104675331 (ITPR2)
   04022 cGMP-PKG signaling pathway
    104675331 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104675331 (ITPR2)
   04210 Apoptosis
    104675331 (ITPR2)
   04218 Cellular senescence
    104675331 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104675331 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675331 (ITPR2)
   04621 NOD-like receptor signaling pathway
    104675331 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    104675331 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104675331 (ITPR2)
   04929 GnRH secretion
    104675331 (ITPR2)
   04912 GnRH signaling pathway
    104675331 (ITPR2)
   04915 Estrogen signaling pathway
    104675331 (ITPR2)
   04921 Oxytocin signaling pathway
    104675331 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    104675331 (ITPR2)
   04918 Thyroid hormone synthesis
    104675331 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    104675331 (ITPR2)
   04924 Renin secretion
    104675331 (ITPR2)
   04925 Aldosterone synthesis and secretion
    104675331 (ITPR2)
   04927 Cortisol synthesis and secretion
    104675331 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104675331 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    104675331 (ITPR2)
   04971 Gastric acid secretion
    104675331 (ITPR2)
   04972 Pancreatic secretion
    104675331 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104675331 (ITPR2)
   04725 Cholinergic synapse
    104675331 (ITPR2)
   04728 Dopaminergic synapse
    104675331 (ITPR2)
   04726 Serotonergic synapse
    104675331 (ITPR2)
   04720 Long-term potentiation
    104675331 (ITPR2)
   04730 Long-term depression
    104675331 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    104675331 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104675331 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104675331 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104675331 (ITPR2)
   05012 Parkinson disease
    104675331 (ITPR2)
   05017 Spinocerebellar ataxia
    104675331 (ITPR2)
   05020 Prion disease
    104675331 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    104675331 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104675331 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104675331 (ITPR2)
   05163 Human cytomegalovirus infection
    104675331 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675331 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104675331 (ITPR2)
Ion channels [BR:rro04040]
 Ligand-gated channels
  IP3 receptor
   104675331 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 104675331
NCBI-ProteinID: XP_010378151
UniProt: A0A2K6Q332
LinkDB
Position
10
AA seq 2700 aa
MTDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDDHPTSKKKRQAGEKIMYTLVSVPHGN
DIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQ
TKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIF
FVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDL
GDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHN
NRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGN
ADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNREPHGKAIRHLAQEAKEGTK
ADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRL
MLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEY
LKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMS
SYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPAEH
EDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSANGSPDTLLPS
AIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLF
KHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEI
GESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRI
QHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNKVMNLAHTFLQNFCRGNPQNQVLLHKHLN
LFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADG
KYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVEL
LAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEI
YTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTS
LQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDGQVNT
LFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVASLEHQFSPMM
QAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREM
LEKKDSFVEEGNTLRKILLNRYFKGDYSIGMNGHLSGAYSKTAQVGGSFSGQDSDKMGIS
MSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQK
KSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKRDDDNELMTSGPRMRVRDSPLHLKE
GMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEATMSPAIGIMQPI
LRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKN
VALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLK
NNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVSP
KDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQI
VFPVPNICEYLTQESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFW
FSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFF
SKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVI
LDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVL
ALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVIGSHQVPTMTLTTMMEACAKENCSPTI
PASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYD
LLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEE
HIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDS
EQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH
NT seq 8103 nt   +upstreamnt  +downstreamnt
atgactgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagttcagagactgccttttcaaggtg
tgccctatgaaccgatattctgcccagaagcaatattggaaagccaagcaagccaaacaa
gggaaccacaccgaggcagccttgctgaagaaactacagcacgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaagctgttgggagaaattgtgaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattgcctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaacgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcaggacagccactacatgccagcaacatagagctt
cttgataacccggggtgtaaagaggtgaatgctgttaattgcaacaccagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattgtttcatgcggaacaagagaagtttttgacttgtgatgagtacgagaaaaaacag
cacattttccttcgtacaaccttgcgccaatcagctacttctgctactagttctaaagca
ctgtgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaaacatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatgaccatccaacttcaaag
aaaaaacgccaggcaggggagaagatcatgtatactttggtttcagtcccacatggcaat
gacattgcatccctttttgaactcgatgccacaactcttcagagagctgactgcctggtt
ccaaggaactcatatgttcggttaaggcatttatgcaccaacacgtgggtaaccagtact
agtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgccaa
accaaagaagataaagaagcattcgccatcgtgtctgtcccactgtctgaagttcgagac
ttagactttgccaatgatgccaataaagtactcgcgaccacagttaaaaagctagaaaat
ggcacaataactcagaatgaaaggaggtttgtaactaaattattggaagacctcatcttc
tttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaagcca
aaccgagagcgtcaaaaattgatgagggaacaaaacatactggcgcaggtatttggaatt
cttaaagcaccctttaaagagaaagcaggagaaggctcaatgctgcgacttgaagatctg
ggggatcaaagatatgcaccctacaagtacatgctgcggctctgttaccgtgtcctgaga
cactctcagcaggattaccggaagaatcaggaatatattgctaagaatttctgtgtcatg
cagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcacaac
aacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagttta
ctcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtctaat
accactgctattcctgtaactcaagaactcatctgtaaatttatgttgagtccaggcaat
gcagacattctcattcaaacgaaggtggtctcaatgcaagcagacaaccccatggagagc
tccatcctttcagatgacattgatgatgaagaagtttggctctattggattgacagcaac
agggaacctcatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcaccaaa
gctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatgtgc
ttggatcgccagtatctggccataaaccagatttctacacagctctctgtagacctgatc
ctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcatccttctgtcgcctc
atgctccacatgcacgttgaccgggatccccaggagtctgtggtgcctgttcgctatgcc
aggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataacagac
tcttcccgaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaatat
ttgaaagaagtcgtaaaccagccctttccttttggggataaagaaaaaaataaactgaca
tttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagtgag
ttattaaggctaacaagaacacttctggctattttagacattgtacaggcccccatgtcg
tcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaaccatt
catggggtgggagagatgatgacccagatggtactcagtagaggttccatcttccccatg
agcgtgccagatgtgccacccagcatccacccgagcaagcaaggcagccccgccgagcat
gaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatcctg
agtgtcagactagattataggatctcatatatgctgtcgatatataagaaggagtttgga
gaggacaatgacaatgcggagacatctgccaatggatctccagatactttactaccgtca
gctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcgggaaga
aaggaaaaaaacccagttcaacttgatgatgaaggaggcaggacatttttacgggtcctc
attcatctgatcatgcacgactacccgcctttgctgtctggagccctgcagctattgttt
aagcacttcagccagagggcagaggttttacaggcatttaagcaggtgcaattactggtg
tctaatcaagatgtagataactacaagcaaatcaaggcagatctagaccagcttcgactg
acagtggagaagtctgagctatgggttgagaagagcagcaactatgagaacggagaaata
ggggaaagtcaagtgaaaggcggtgaagagccaattgaggaatcgaacattttaagtcca
gtacaggatggaacaaagaaacctcagattgacagcaacaagagcaataactaccggatt
gtaaaggagattttgattaggctaagtaaactctgtgtacagaataaaaagtgtcggatt
caacatcaacgattactgaaaaatatgggggcacattcagtggtgttggatcttctccag
ataccctacgaaaagaacgatgaaaagatgaacaaagtaatgaatctagcccatacgttt
ctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctgaat
ttgtttttaactccaggtctccttgaagcagaaaccatgcggcacatcttcatgaacaat
taccatctgtgcaacgaaattagcgagagagttgtacagcactttgtgcactgcattgag
acacatggccgccacgtggagtacctgaggtttttgcaaacaattgtgaaagcagatggt
aaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaagat
gtgctgatattttacaatgatagagcgtcatttccaatccttctccatatgatgtgttca
gagagagaccgaggggacgagagtggccccttagcctaccacatcaccctggtggagctg
ctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattcccttctc
ccgctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaaatt
gcttatgtgaactttgttaatcactgttacgttgacactgaagtggaaatgaaagaaatc
tatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagggtt
tgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgttactgag
tcaataatgaatattgtgagcggcttctttaattctcccttttcagacaatagtaccagc
ctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttacaat
tgcacctggccaaacccggcacagaaagcctcggtagaatcctgtatcagaactttagct
gaagtggcaaaaaatcgtggaattgccattccagtggatttggacggccaagttaatact
cttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagactatca
gctcgctctgggccacgctttaaggaagctcttggagggccttcttgggattacagaaat
attattgaaaagttacaggatgtagtggcctccttggagcaccagttcagcccaatgatg
caggctgaattctcagtgttggttgatgtattgtacagtccagagctgctgttccctgag
ggaagcgatgcaagaataagatgtggtgctttcatgtcaaagttgattaatcatacaaag
aaactaatggagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaaatg
ttagagaagaaagacagctttgtggaagagggtaacacattaagaaagatacttctgaat
cgatactttaaaggtgattatagtattggcatgaatggacacctatcaggagcctactcc
aaaactgcacaggtgggaggaagcttttctggacaagattcagataagatgggaatatca
atgtcagatattcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgatgtt
atagtgaacaccaaaaatgacagaattttttcggaaggcattttcctcggcattgccttg
cttgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaaaaa
aagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaaata
agatcaacagtgacagttaataccatagatttaggtagcaaaaaaagggatgatgacaat
gaattgatgacatctggtccacgaatgagagtaagagattcaccactacatttaaaagag
ggaatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatattgtgtatac
agaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcaggaaacact
gaggaaaaatctgcagaggaagcgacaatgagtcctgcaattggcatcatgcagccaata
ctgagatttcttcagttactgtgtgagaatcacaaccgcgaattgcagaacttcttgagg
aatcaaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttctggactgc
atttgcggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaagaac
gtagcactggtcaaccagaccctggagagcttgactgagtattgccagggcccctgccat
gaaaatcagacctgtatcgctacacatgagtctaatgggattgatatcatcattgctttg
attctgaatgacataaaccctcttggtaaataccgaatggatctggtgctccagctaaag
aacaatgcatctaaacttttactggccattatggaaagcagacatgacagcgagaacgca
gaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcctac
aaccaaggattggaatgtgaccatggggatgatgagggtggagatgatggtgtttctcca
aaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaacta
ttgcagcagatgctcaaaccaggatcggatccagatgaaggagatgaagccttaaagtat
tatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaaata
gtttttcctgtccccaatatatgtgaatacctcactcaagaatccaagtgccgtgtgttc
aatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaacagaa
gatctctacaatgaaatgaagtggcaaaagaaaatcaggaataaccctgcactgttctgg
ttctcaaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatcaat
ttagctgttgctctcttctacccatttggggatgatggagatgaaggtacactttctcca
ttgttctcggttcttctttggatagcagttgcgatctgcacatctatgctgtttttcttc
tccaagcctgtgggtattcggccgtttcttgtatcaataatgctcagatcaatatacaca
ataggtcttgggcctaccttaatacttcttggtgcagctaatctttgtaataaaattgta
tttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtcatc
ctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggccttttt
gtccatgaattcttctatagcttcctgctttttgatttggtgtacagagaagagactctg
ctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtcctg
gctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgacttc
actatggaagttgataggctgaaaaaccgaactcctgttataggcagtcatcaagtgcct
accatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccacaatt
ccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgacact
ctccttatgtgcattgtcaccgtgctgaaccagggcctcaggaacggcggtggtgtgggg
gatgtgctaagaaggccatcaaaagatgagcccttgtttgctgcccgagtggtttatgac
cttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatcatc
gacacttttgctgatctcagaagtgaaaaacagaaaaaagaagaaattctaaagacaact
tgtttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgaggag
cacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaagtt
aaagacccaacagaatacactggacctgaaagttacgtggctcaaatgattgtggagaag
aatttggattggtttcctcggatgcgagccatgtccctcgttagcaatgaaggcgacagt
gagcaaaatgaaattcggaaccttcaggagaagttggaatcgaccatgagtctggtcaaa
cagctgtcgggtcagctggcagagctcaaggagcagatgacagaacaaaggaagaataag
cagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatgccaccacac
tga

DBGET integrated database retrieval system