KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658958
Entry
104658958         CDS       T03989                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05160  Hepatitis C
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104658958 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104658958 (BAK1)
   04215 Apoptosis - multiple species
    104658958 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658958 (BAK1)
   05202 Transcriptional misregulation in cancer
    104658958 (BAK1)
   05206 MicroRNAs in cancer
    104658958 (BAK1)
   05203 Viral carcinogenesis
    104658958 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104658958 (BAK1)
   05212 Pancreatic cancer
    104658958 (BAK1)
   05225 Hepatocellular carcinoma
    104658958 (BAK1)
   05226 Gastric cancer
    104658958 (BAK1)
   05214 Glioma
    104658958 (BAK1)
   05216 Thyroid cancer
    104658958 (BAK1)
   05220 Chronic myeloid leukemia
    104658958 (BAK1)
   05217 Basal cell carcinoma
    104658958 (BAK1)
   05218 Melanoma
    104658958 (BAK1)
   05213 Endometrial cancer
    104658958 (BAK1)
   05224 Breast cancer
    104658958 (BAK1)
   05222 Small cell lung cancer
    104658958 (BAK1)
   05223 Non-small cell lung cancer
    104658958 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    104658958 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104658958 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104658958 (BAK1)
   05160 Hepatitis C
    104658958 (BAK1)
   05164 Influenza A
    104658958 (BAK1)
   05162 Measles
    104658958 (BAK1)
   05168 Herpes simplex virus 1 infection
    104658958 (BAK1)
   05163 Human cytomegalovirus infection
    104658958 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104658958 (BAK1)
   05169 Epstein-Barr virus infection
    104658958 (BAK1)
   05165 Human papillomavirus infection
    104658958 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104658958 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rro03029]
    104658958 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104658958 (BAK1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    104658958 (BAK1)
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104658958 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 104658958
NCBI-ProteinID: XP_010357419
UniProt: A0A2K6N8B6
LinkDB
Position
4
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcgggacaaggcccaggtcctcccaggcaggaatgcggagagcctgccctgcct
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttgcccctgcaacctagcagcaccatgggacaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgctgcagcacctg
cagcccacggcagagaacgcctatgagtacttcaccaagattgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcgcggcctgactggcttcctgggccaggtgacccgcttcgtggtcgat
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system