KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659193
Entry
104659193         CDS       T03989                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04261  Adrenergic signaling in cardiomyocytes
rro04540  Gap junction
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04970  Salivary secretion
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104659193 (ADRB1)
   04024 cAMP signaling pathway
    104659193 (ADRB1)
   04022 cGMP-PKG signaling pathway
    104659193 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104659193 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104659193 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104659193 (ADRB1)
   04924 Renin secretion
    104659193 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104659193 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    104659193 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104659193 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104659193 (ADRB1)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    104659193 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 104659193
NCBI-ProteinID: XP_030797100
LinkDB
Position
11
AA seq 480 aa
MGAGALVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASEGPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPSPVPAPAPPPGPLRPATAAAT
TAPLVNGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDR
LFVFFNWLGYANSAFNPIIYCRSPDFRNAFQRLLCCARRAARRRHAAHGDRPRALGCLAR
PGPPPSPGAASDDDEDDVVGATQPARLLEPWAGCNGGAAADSDSSLDEPCRPEFASESKV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgccgcccgccagcgaaggccccgagccgctgtcgcagcagtggacggcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaacgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcggtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcagccctggtgtcctttctgcccattctcatgcattggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgatttcgtcacc
aaccgggcctacgccatcgcctcgtccgtggtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggccccgcgcggccgccctcgccctcgccctcgccctcg
ccggtccccgcgcccgcgccgccgcccggacccctgcgccccgccaccgccgctgccacc
accgccccgctggtcaacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctg
cgcgagcagaaggcgctcaagacgctgggcatcatcatgggcgtgttcacgctctgttgg
ctgcccttcttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgc
ctcttcgtcttcttcaactggctgggctacgccaactcggccttcaaccccatcatctac
tgccgcagccccgacttccgcaacgccttccagcgactgctctgctgcgcgcgcagggct
gcccgccggcgccacgcggcccacggagaccggccgcgcgccttgggctgtctggcccgg
cccggacccccgccgtcgcccggggccgcctcggacgacgacgaagacgatgtcgtcggg
gccacgcagcccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcg
gacagcgactcgagcctggacgagccgtgccgccccgaattcgcctcggagtccaaggtg
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679651
Entry
104679651         CDS       T03989                                 

Gene name
ADRB3
Definition
(RefSeq) LOW QUALITY PROTEIN: beta-3 adrenergic receptor
  KO
K04143  adrenergic receptor beta-3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04714  Thermogenesis
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104679651 (ADRB3)
   04022 cGMP-PKG signaling pathway
    104679651 (ADRB3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104679651 (ADRB3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104679651 (ADRB3)
   04924 Renin secretion
    104679651 (ADRB3)
  09154 Digestive system
   04970 Salivary secretion
    104679651 (ADRB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    104679651 (ADRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104679651 (ADRB3)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    104679651 (ADRB3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 104679651
NCBI-ProteinID: XP_010383600
UniProt: A0A2K6NDK8
LinkDB
Position
9
AA seq 408 aa
MAPWPHGNSSLVPWPDVPTLAPNTANTSGLPGVPWAAALAGALLALAVLATVGGNLLVIV
AITRTPRLQTMTNVFVTSLAAADLVMGLLVVPPAATLVLTGHWPLGATGCELWTSVDVLC
VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSQWWRV
GADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRG
ELGRFPPEESPPALSRSLAPAPAGTCAPPEGVPACCRWPARLLPLREHRALCTLGLIMGT
FTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL
CHCGGRLPREPRAAAXHGLIPSGAPEARTSPAQPRLCQRLDGASWEVS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggctccgtggcctcatgggaacagttctctagtcccttggccggacgtccccaccctg
gcgcccaataccgccaacaccagtgggctgccaggggtgccatgggcggcggccctggcc
ggggcgctgctggcgctggcggtgctggccaccgtgggaggcaatctgctggtcatcgtg
gccatcacccggacgccgaggctccagaccatgaccaacgtgttcgtgacttcgctggcc
gcagccgacctggtgatgggactcctggtggtgccgccggcggccacattggtgctgact
ggccactggccgttgggcgccactggctgcgagctgtggacctcggtggacgtgctgtgt
gtgaccgccagcatcgaaaccctgtgcgccctggccgtggaccgctacctggctgtgacc
aacccgctgcgttacggcgcactggtcaccaagcgccgcgccagggcagccgtggtcctc
gtgtgggtcgtgtcggccgcggtgtcgtttgcgcccatcatgagccagtggtggcgcgta
ggggccgacgccgaggcgcagcgctgccactccaaccctcgctgctgtgccttcgcctcc
aacatgccctatgtgctgctgtcctcctccgtctccttctaccttcctcttctcgtgatg
ctcttcgtctacgcgcgggttttcgtggtggctacgcgccagctgcgcttgctgcgcggg
gagctcggccgctttccgccggaggagtctccgcccgcgctgtcgcgctctctggccccg
gccccggctgggacgtgcgctccgcctgaaggggtgcccgcctgctgccgctggcccgcg
cgcctcctgcctctccgggaacaccgggccctgtgcaccttgggtctcatcatgggcacc
ttcactctctgctggttgcccttctttctggccaacgtgctgcgcgccctcgggggcccc
tctctcgtcccgggcccggctttccttgccctgaactggctaggttatgccaattctgcc
ttcaacccgctcatctactgccgcagcccggactttcgcagcgccttccgccgtcttctg
tgccactgcggcggtcgcctgcctagggagccccgcgccgccgccnctcacggcctcatc
ccctccggcgcccctgaggcccggaccagccccgcgcagcccaggctttgccaacggctc
gacggggcttcttgggaagtttcttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680760
Entry
104680760         CDS       T03989                                 

Gene name
ADRB2
Definition
(RefSeq) beta-2 adrenergic receptor
  KO
K04142  adrenergic receptor beta-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04261  Adrenergic signaling in cardiomyocytes
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104680760 (ADRB2)
   04024 cAMP signaling pathway
    104680760 (ADRB2)
   04022 cGMP-PKG signaling pathway
    104680760 (ADRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104680760 (ADRB2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    104680760 (ADRB2)
   04924 Renin secretion
    104680760 (ADRB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104680760 (ADRB2)
  09154 Digestive system
   04970 Salivary secretion
    104680760 (ADRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104680760 (ADRB2)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    104680760 (ADRB2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 104680760
NCBI-ProteinID: XP_010385143
UniProt: A0A2K6NNH9
LinkDB
Position
3
AA seq 415 aa
MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQK
AINCYAKETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKACGNGYSSNSNG
NTGEQSGYHLEQEKENKLLCEDLPGREDFVGHQGTVPSDNIDSQGRSCSTNDSLL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggggcaacccgggaacggcagcgccttcctgctggcacccaacggaagccatgcgccg
gaccacgacgtcacgcaggaacgggacgaggcgtgggtggtgggcatgggcatcgtcatg
tctctcatcgtcctggccatcgtgtttggcaatgtgctggtcatcacagccattgccaag
ttcgagcgtctgcagacggtcaccaactacttcatcacttcactggcctgtgctgacttg
gtcatgggcttggcagtggtgccctttggggccgcccatattctcatgaaaatgtggact
tttggcaacttctggtgcgagttttggacttccattgatgtgctgtgcgtcacggccagc
attgagaccctgtgcgtgatcgcagtggatcgctactttgccattacttcacccttcaag
taccagagcctgctgaccaagaataaggcccgggtgatcattctgatggtgtggatcgtg
tcaggccttacctccttcttgcccattcagatgcactggtaccgggccacccaccagaaa
gctatcaactgctatgccaaggagacctgctgtgacttcttcacgaaccaagcctatgcc
attgcctcctccatcgtgtccttctacgttcccctggtgatcatggtcttcgtctactcc
agggtctttcaggaagccaaaaggcagctccagaagattgacaaatctgagggccgcttc
catgcccagaaccttagccaggtggagcaggatgggcggacagggcatggactccgcaga
tcttccaagttctgcttgaaggagcacaaagccctcaagacgttaggcatcatcatgggc
actttcaccctctgctggctgcccttcttcatcgttaacattgtgcatgtgatccaggat
aacctcatccctaaggaagtttacatcctcctaaattgggtgggctatgtcaattctgct
ttcaatccccttatctactgccggagcccggatttcaggattgccttccaggagcttctg
tgtctgcgcaggtcttctttgaaggcctgtgggaatggctactccagcaacagcaatggc
aacacaggggagcagagtggatatcacctggaacaggagaaagaaaacaaactgctgtgt
gaagacctcccaggcagggaagactttgtgggccatcaaggtactgtgcctagcgataac
attgattcacaagggaggagttgtagtacaaatgactcactgctgtga

DBGET integrated database retrieval system