KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659649
Entry
104659649         CDS       T03989                                 

Gene name
SLC8A3
Definition
(RefSeq) sodium/calcium exchanger 3 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro04740  Olfactory transduction
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04974  Protein digestion and absorption
rro04978  Mineral absorption
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104659649 (SLC8A3)
   04020 Calcium signaling pathway
    104659649 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    104659649 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104659649 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    104659649 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    104659649 (SLC8A3)
   04978 Mineral absorption
    104659649 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104659649 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    104659649 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104659649 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104659649 (SLC8A3)
   05414 Dilated cardiomyopathy
    104659649 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104659649 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659649 (SLC8A3)
Transporters [BR:rro02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   104659649 (SLC8A3)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Others
   104659649 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 104659649
NCBI-ProteinID: XP_010358055
UniProt: A0A2K6NSH5
LinkDB
Position
5
AA seq 928 aa
MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNIRIEEEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIHI
KVIDDEAYEKNKNYFIEMMGPRMVDMSFQKALLLSPELTDRKLTMEEEEAKRIAEMGKPV
LGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDES
GEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHF
GCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLA
WSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPQLGGELGGPRGCKL
ATTWLFVSLWLLYILFATLEAYCYIKGF
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggcgtggttaaggttgcagcctctcacctctgccttcctccattttggcctggttacc
tttgtactcttcctgaatggtcttcgagcagaggctggtggctcaggggatgtgccaagc
acagggcagaacaatgagtcctgttcagggtcatcggactgcaaggagggtgtcatcctg
ccaatctggtacccggagaacccttcccttggggacaagattgccagggtcattgtctat
tttgtggccctgatatacatgttcctgggggtgtccatcattgctgaccgcttcatggca
tctattgaagtcatcacctctcaagagagagaggtgacaattaaaaaacccaatggagaa
accagcacaaccactattcgggtctggaatgaaactgtctccaacctgacccttatggcc
ctgggttcctctgctcctgagatactcctctctttaattgaggtgtgtggtcatgggttc
attgctggtgatctgggaccttctaccattgtagggagtgcagccttcaacatgttcatc
atcattggcatctgtgtctacgtgatcccagatggagagactcgcaagatcaagcaccta
cgagtcttcttcatcactgctgcttggagtatctttgcttacatctggctctatatgatt
ctggcagtcttctcccctggtgtggtccaggtttgggagggcctcctcactctcttcttc
tttccagtgtgtgtccttctggcctgggtggcagataaacgactgctcttctacaaatac
atgcacaaaaagtaccgcacagataaacaccgaggaattatcatagagacagagggtgac
caccctaagggcattgagatggatgggaaaatgatgaattcccattttctagatgggaac
ctggtgcccctggaagggaaggaagtggatgagtcccgcagagagatgatccggattctc
aaggatctgaagcaaaaacacccagagaaagacttagatcagctggtggagatggccaat
tactatgctctttcccaccaacagaagagccgcgccttctaccggatccaagccacccgt
atgatgactggtgcaggcaatatcctgaagaaacatgcagcagaacaagccaagaaggcc
tccagcatgagcgaggtgcatactgatgagcctgaggactttatttccaaggtcttcttt
gacccgtgttcttaccagtgcctggagaactgtggggctgtactcctgacagtggtgagg
aaaggcggagatatgtcaaagaccatgtatgtggactacaaaacagaggatggttctgcc
aatgcaggggctgactatgagttcacagagggcacggtggttctgaagccaggagagacc
cagaaggagttctccgtaggcattattgatgatgacatttttgaggaggatgaacacttc
tttgtaaggttgagcaatatccgcatagaggaggagcagccggaggaggggatgcctcca
gcaatattcaacagtcttcccttgcctcgggctgtcctagcctccccttgtgtggccaca
gttaccatcttggatgatgaccatgcaggcatcttcacttttgaatgtgatactattcat
gtcagtgagagtattggtgttatggaagtcaaggttctgcggacatcaggtgcgcggggt
acagtcatcgtcccctttaggacagtagaagggacagccaagggtggcggtgaggacttt
gaagacacatatggggagctggaattcaagaatgatgaaactgtcaaaacaattcacatc
aaggtaattgatgatgaggcgtatgagaaaaacaagaattacttcattgagatgatgggc
ccccgcatggtggatatgagttttcagaaagcgctcctgttatctccagagttgacagac
aggaagctgactatggaggaagaagaggccaagaggatagcagagatgggaaagccagta
ttgggtgaacaccccaaactagaagtcatcatcgaagagtcctatgagttcaagactacg
gtggacaaactgatcaagaagacaaacctggccttggttgtggggacccattcctggagg
gaccagttcatggaggccatcaccgtcagtgcagcaggggatgaggatgaggatgaatcc
ggggaggagaggctgccctcctgctttgactacgtcatgcacttcctgacagtcttctgg
aaggtgctgtttgcctgtgtgccccccacagagtactgccacggctgggcctgcttcgcc
gtctccatcctcatcatcggcatgctcaccgccatcattggggacctggcctcgcacttt
ggctgcaccattggtctcaaggattcagtcacagctgttgttttcgtggcatttggcacc
tctgtcccagatacgtttgccagcaaagctgctgccctccaggatgtatatgcagacgcc
tccattggcaacgtgacgggcagcaacgccgtcaacgtcttcctgggcattggcctggcc
tggtccgtggccgccatctactgggctctgcagggacaggagttccacgtatcagctggc
acgctggccttctccgtcaccctcttcaccatctttgcatttgtctgcatcagcgtgctc
ttgtacagacggcggccacaactgggaggggagcttggtggcccccgtggctgcaagctt
gccacgacatggctctttgtaagcctgtggctcctctacatactctttgccacactagag
gcctattgctacattaaggggttctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663033
Entry
104663033         CDS       T03989                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro04740  Olfactory transduction
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04974  Protein digestion and absorption
rro04978  Mineral absorption
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104663033 (SLC8A1)
   04020 Calcium signaling pathway
    104663033 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    104663033 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104663033 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    104663033 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    104663033 (SLC8A1)
   04978 Mineral absorption
    104663033 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104663033 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    104663033 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663033 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104663033 (SLC8A1)
   05414 Dilated cardiomyopathy
    104663033 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104663033 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104663033 (SLC8A1)
Transporters [BR:rro02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   104663033 (SLC8A1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Others
   104663033 (SLC8A1)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 104663033
NCBI-ProteinID: XP_010362453
LinkDB
Position
17
AA seq 970 aa
MRRLSLSPTFSMGFHLLVIVALLFSHVDYVIAETEMEGEGNETGECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGIVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVENF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLYGQPVFRK
VHAREHPILSTVITITDEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFK
STVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTV
FWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVAL
GTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVS
PGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSS
LEAYCHIKGF
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgcggcgattaagtctttcacccaccttttcaatgggatttcatctgttagttattgtg
gctctcttattttcccatgtggactacgtaattgccgagacagaaatggaaggagaagga
aatgaaactggtgaatgcactggctcatattactgtaagaaaggggtaattttgcccatt
tgggaaccccaagacccttcttttggggacaaaattgctagagctactgtgtattttgtg
gccatggtctacatgtttcttggagtctctatcatagctgatcggttcatgtcctctata
gaagtcatcacatcccaagaaaaagaaataaccataaagaaacccaatggagagaccacc
aagacaactgtgaggatctggaatgagacagtttctaacctgaccttgatggccctggga
tcttctgctcctgagattctcctttcagtaattgaagtgtgcggccataactttactgca
ggagacctcggtcctagcaccatcgtgggaagtgctgcattcaacatgttcatcattatt
gcactctgtgtttacgtggtccctgacggagagacaaggaagattaagcatttgcgtgtg
ttctttgtgacggcagcctggagcatctttgcctacacctggctttacattattttgtct
gtcatctctcctggcattgtggaggtctgggaaggtttgcttactttcttcttctttccc
atctgtgttgtgttcgcttgggtggcagataggagacttctgttttacaagtatgtctac
aagaggtatcgagctggcaagcagagggggatgattattgaacatgaaggagacaggcca
tcttccaagactgaaattgaaatggatgggaaagtggtcaattctcatgttgaaaatttc
ttagatggtgctctggttctggaggtggatgagagggaccaagatgatgaagaagctagg
cgagaaatggctaggattctgaaggaacttaagcagaagcatccagagaaagaaatagag
caattaatagaattagctaactaccaagtcctaagtcagcagcaaaaaagtagagcattt
taccgcattcaagctactcgcctgatgactggagctggcaatattttaaagaggcatgca
gctgaccaagcaaggaaggctgtcagcatgcacgaggtcaacactgaagtgactgaaaat
gaccccgttagtaagatcttctttgaacaagggacatatcagtgtctggagaactgtggt
actgtggcccttaccattatccgcagaggtggtgatttgaccaacactgtgtttgttgac
ttcagaacagaggatggcaccgcaaatgctgggtctgattatgaatttactgaaggaact
gtggtgtttaagcctggtgagacccagaaggaaatcagagtgggtatcatagatgatgat
atatttgaggaggatgaaaatttccttgtgcatctcagcaatgtcaaagtatcttctgaa
gcttcagaagatggcatactcgaagccaatcatgtttctacacttgcttgcctcggatct
ccctccactgccactgtaactatttttgatgatgaccacgcaggcatttttacttttgag
gaacctgtgactcatgtgagtgagagcattggcatcatggaggtgaaagtactgagaaca
tctggagctcgaggaaatgttatcgttccatataaaaccatcgaaggaactgccagaggt
ggaggggaggattttgaggacacttgtggagagcttgaattccagaatgatgaaattgtc
aaaacaatatcagtcaaggtaattgatgatgaggaatatgagaaaaacaagaccttcttc
cttgagattggagagccccgcctggtggagatgagtgagaagaaagccctgttattgaat
gagcttggtggcttcacaataacaggaaaatacctgtatggccaacctgtcttcaggaag
gttcatgctagagaacatccgattctctctactgtaatcaccattacagatgaatatgat
gacaagcagccactgaccagcaaagaggaagaggagagacgcattgcagaaatgggacgc
cccatcctgggagagcacaccaagttggaagtgatcattgaagaatcctatgaattcaag
agtactgtggacaaactcattaagaagacaaacctggcccttgtggttgggacaaacagc
tggagagaacagttcattgaagctatcactgtcagtgctggggaagatgacgacgacgat
gaatgtggggaagagaagctgccctcctgttttgattacgtgatgcactttctgactgtg
ttctggaaggtcctctttgccttcgtcccccctactgaatactggaatggctgggcgtgt
ttcattgtctccatcctcatgattggcctactgacagctttcattggagacctggcttcc
cactttggctgcaccattggcctgaaagattctgtgactgcagtcgtgttcgtcgcactt
ggaacatcagtgccagacacatttgccagcaaagtggcagccacccaggaccagtatgca
gacgcctccataggtaacgtcacaggcagcaacgcggtgaacgtcttcctgggaatcggt
gtggcctggtccatcgctgccatctaccatgcagccaatggggaacagttcaaagtgtcc
cctggcacgctagctttctctgtcactctcttcaccatttttgctttcatcaatgtgggg
gtgctgctgtatcggcggaggccagaaatcggaggtgagctgggtgggccccggactgcc
aagctcctcacatcctgcctctttgtgctcctatggctcttgtacattttcttctcctcc
ctggaggcctactgccacataaaaggcttctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673384
Entry
104673384         CDS       T03989                                 

Gene name
SLC8A2
Definition
(RefSeq) sodium/calcium exchanger 2 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro04740  Olfactory transduction
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04974  Protein digestion and absorption
rro04978  Mineral absorption
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104673384 (SLC8A2)
   04020 Calcium signaling pathway
    104673384 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    104673384 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104673384 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    104673384 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    104673384 (SLC8A2)
   04978 Mineral absorption
    104673384 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    104673384 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    104673384 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104673384 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104673384 (SLC8A2)
   05414 Dilated cardiomyopathy
    104673384 (SLC8A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104673384 (SLC8A2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104673384 (SLC8A2)
Transporters [BR:rro02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   104673384 (SLC8A2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Others
   104673384 (SLC8A2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 104673384
NCBI-ProteinID: XP_030769517
LinkDB
Position
12
AA seq 921 aa
MAPLALVGVALLLAAPPCSGAATPTPSLPPPPANDSDTNTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGP
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRASPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggctcccctggccttggtgggggtcgcactcctcctggcggctcccccatgctccggg
gcagccaccccaaccccctccctgccgcctcccccggccaatgacagcgacaccaacaca
gggggctgccaggggtcctaccgctgccagccgggggtgctgctgcccgtgtgggagccc
gacgacccatcgctgggtgacaaggcggcacgggcagtggtctactttgtggccatggtc
tacatgtttctgggagtgtccatcatcgccgaccgcttcatggcggccatcgaggtcatc
acatcaaaagaaaaggagatcaccatcaccaaggccaacggcgagaccagcgtgggcacc
gttcgcatttggaacgagacagtgtccaacctcacgctcatggccctgggctcctctgca
cccgagatcctgctgtcagtcatcgaggtctgcggtcacaacttccaggcgggtgagctg
ggcccaggcaccatcgtgggcagcgctgccttcaacatgtttgtggtcattgctgtgtgc
atctatgtcatcccagccggcgagagccgcaagatcaagcacctgagagtcttcttcgtc
actgcctcttggagcatcttcgcctatgtttggctttatctcatccttgctgttttttcc
ccgggtgtggtccaggtgtgggaggcgctgctgaccctggtcttcttcccggtgtgcgtg
gtattcgcctggatggccgacaagcggctcctcttctacaagtatgtgtacaagcgctac
cgcaccgacccgcgcagcggcatcatcataggcgcagagggcgaccccccgaagagcatc
gagctggacggcacgttcgtgggcgccgaggccccaggcgagctgggcggcctgggcccg
ggccctgccgaggcgcgcgagctggatgccagccgccgcgaggtcatccagatcctcaag
gacctcaagcagaagcacccggacaaggacctggagcaactggtgggcatcgccaactac
tacgcgctgctgcaccagcagaagagccgcgccttctaccgcatccaggccactcggctc
atgaccggcgctgggaacgtgctgcgcagacacgcggcggacgcctcacgcagggcgtcg
ccggccgagggcgcgggcgaggacgaggacgacggcgccagccgcatcttcttcgagccc
agcctctaccactgcttggagaactgcggctccgtgctgctgtccgtcacgtgccagggc
ggcgagggcaacagcaccttctacgtggactaccgcactgaggacggctcggccaaggcg
ggctccgactacgagtacagcgagggcacgctggtgttcaaaccaggcgagacacagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcatttcttcgtg
cggctgctgaacctgcgcgtgggcgatgcgcagggcatgttcgagccggacggcggcggg
cggcccaaggggcggctggtggcgccgctgctggccaccgtcaccatcctggacgacgac
cacgcaggcatcttctccttccaggaccgcctgctgcacgtgagcgagtgcatgggcacc
gtggacgtgcgcgtcgtgcgcagctcgggcgcgcgcggcaccgtgcgcctcccctaccgc
acggtggacggcacggcgcgcggcggcggcgtgcactatgaggacgcgtgcggagagctg
gagtttggcgacgacgagaccatgaaaactcttcaggtgaagatagttgatgacgaggaa
tatgagaaaaaggataatttcttcattgagctgggccagccccagtggcttaaacgaggg
atttcagctctgctactcaatcaaggggatggggacaggaagctaacagccgaggaggag
gaggctcgaaggatagcagagatgggcaagccagttcttggggaaaactgccggctggag
gtcatcatcgaggagtcgtatgattttaagaacacagtggataaactcatcaagaaaacg
aacttggccttggtaatcgggacccattcatggagggagcagtttttagaggcaattacg
gtgagcgcaggggacgaggaggaggaggaggacgggtcccgggaggagcggctgccgtcg
tgctttgactacgtgatgcacttcctgacggtgttctggaaggtgctctttgcctgcgtg
ccccccaccgagtactgccacggctgggcctgctttggcgtctccatcctggtcatcggc
ctgctcaccgccctcattggggacctcgcctcccacttcggctgcaccgttggcctcaag
gactctgtcaatgctgttgtcttcgtggccctgggcacctctatccctgacacgttcgcc
agcaaggtggcggcgctgcaggaccaatgcgccgacgcgtccatcggcaacgtgaccggc
tccaacgcggtgaacgtgttcctcggcctgggtgtcgcctggtcggtggccgccgtgtac
tgggcggtgcagggccgccccttcgaggtgcgtactggcacgctggccttctccgtcacg
ctcttcaccgtcttcgccttcgtgggcattgccgtgctgctgtaccggcgccggccgcac
atcggcggcgagctgggcggcccgcgcggacccaagcttgccaccaccgcgctcttcctg
ggcctctggctcctgtacatcctcttcgctagcctggaggcgtactgccacatccggggc
ttctag

DBGET integrated database retrieval system