KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659700
Entry
104659700         CDS       T03989                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04068  FoxO signaling pathway
rro04150  mTOR signaling pathway
rro04270  Vascular smooth muscle contraction
rro04510  Focal adhesion
rro04650  Natural killer cell mediated cytotoxicity
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104659700 (BRAF)
   04012 ErbB signaling pathway
    104659700 (BRAF)
   04015 Rap1 signaling pathway
    104659700 (BRAF)
   04068 FoxO signaling pathway
    104659700 (BRAF)
   04024 cAMP signaling pathway
    104659700 (BRAF)
   04150 mTOR signaling pathway
    104659700 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104659700 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104659700 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104659700 (BRAF)
   04062 Chemokine signaling pathway
    104659700 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104659700 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    104659700 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    104659700 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104659700 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    104659700 (BRAF)
   04720 Long-term potentiation
    104659700 (BRAF)
   04730 Long-term depression
    104659700 (BRAF)
   04722 Neurotrophin signaling pathway
    104659700 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659700 (BRAF)
   05205 Proteoglycans in cancer
    104659700 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104659700 (BRAF)
   05212 Pancreatic cancer
    104659700 (BRAF)
   05225 Hepatocellular carcinoma
    104659700 (BRAF)
   05226 Gastric cancer
    104659700 (BRAF)
   05214 Glioma
    104659700 (BRAF)
   05216 Thyroid cancer
    104659700 (BRAF)
   05221 Acute myeloid leukemia
    104659700 (BRAF)
   05220 Chronic myeloid leukemia
    104659700 (BRAF)
   05218 Melanoma
    104659700 (BRAF)
   05211 Renal cell carcinoma
    104659700 (BRAF)
   05219 Bladder cancer
    104659700 (BRAF)
   05215 Prostate cancer
    104659700 (BRAF)
   05213 Endometrial cancer
    104659700 (BRAF)
   05224 Breast cancer
    104659700 (BRAF)
   05223 Non-small cell lung cancer
    104659700 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104659700 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    104659700 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    104659700 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104659700 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104659700 (BRAF)
   05160 Hepatitis C
    104659700 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104659700 (BRAF)
   01522 Endocrine resistance
    104659700 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104659700 (BRAF)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104659700 (BRAF)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104659700 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 104659700
NCBI-ProteinID: XP_010358114
LinkDB
Position
6
AA seq 762 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAAASSAADPAVPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEYLGNGTDFSVSSSASMDTVTSSS
SSSLSVLQSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKAL
MMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTL
AFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEA
SLAETALTSGSSPSAPTSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSS
APNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKML
NVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWS
GSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQI
IFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIH
RSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccctgccgttccg
gaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcccta
ttggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaa
tacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatatctgggg
aacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatcttcttcc
tcttctagcctttcagtgctacaatctctttcagtttttcaaaatcccacagatgtggca
cggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctacccaacaaacag
aggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaagaaagcactg
atgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaag
aaaccaattggctgggacactgatatttcctggcttactggagaagaattgcatgtggaa
gtgttggagaatgttccacttacaacacacaactttgtacgaaaaacatttttcacctta
gcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgtggt
tataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaa
cttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaagaggcc
tccttagcagagactgccctaacatctggatcatccccttccgcacccacctcagactct
attgggccccaaattctcaccagtccgtctccttcaaaatccattccaattccacagccc
ttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccggtcctcatca
gctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttgattagagac
caaggatttcgtggtgatggaggatcaaccacaggtttgtctgccaccccccctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcgagaa
aggaagtcatcttcatcctcagaagacaggaatcggatgaaaacacttggtagacgggac
tcgagtgatgattgggagattcctgatgggcagattacagtgggacaaagaattggatct
gggtcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttg
aatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagtaggagtactc
aggaaaacacgacacgtgaatatcctactcttcatgggctattccacaaagccacaacta
gctattgttacccagtggtgcgagggctccagcttgtatcaccatctccatatcattgag
accaaatttgagatgatcaaacttatagatattgcacgacagactgcacagggcatggat
tacttacacgccaagtcaatcatccacagagacctcaagagtaataatatatttcttcat
gaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatctcgatggagt
gggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagtcatc
agaatgcaagataaaaatccatacagctttcagtcggatgtatatgcctttgggattgtt
ctgtatgaattgatgactggacagttaccttattcaaacatcaataacagggaccagata
atttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagtaactgt
ccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagatgaaagacca
ctctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaattcac
cgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggattttagtcta
tatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaatttgcagcc
ttcaagtag

DBGET integrated database retrieval system