KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659700
Entry
104659700         CDS       T03989                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04068  FoxO signaling pathway
rro04150  mTOR signaling pathway
rro04270  Vascular smooth muscle contraction
rro04510  Focal adhesion
rro04650  Natural killer cell mediated cytotoxicity
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104659700 (BRAF)
   04012 ErbB signaling pathway
    104659700 (BRAF)
   04015 Rap1 signaling pathway
    104659700 (BRAF)
   04068 FoxO signaling pathway
    104659700 (BRAF)
   04024 cAMP signaling pathway
    104659700 (BRAF)
   04150 mTOR signaling pathway
    104659700 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104659700 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104659700 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104659700 (BRAF)
   04062 Chemokine signaling pathway
    104659700 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104659700 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    104659700 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    104659700 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104659700 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    104659700 (BRAF)
   04720 Long-term potentiation
    104659700 (BRAF)
   04730 Long-term depression
    104659700 (BRAF)
   04722 Neurotrophin signaling pathway
    104659700 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659700 (BRAF)
   05205 Proteoglycans in cancer
    104659700 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104659700 (BRAF)
   05212 Pancreatic cancer
    104659700 (BRAF)
   05225 Hepatocellular carcinoma
    104659700 (BRAF)
   05226 Gastric cancer
    104659700 (BRAF)
   05214 Glioma
    104659700 (BRAF)
   05216 Thyroid cancer
    104659700 (BRAF)
   05221 Acute myeloid leukemia
    104659700 (BRAF)
   05220 Chronic myeloid leukemia
    104659700 (BRAF)
   05218 Melanoma
    104659700 (BRAF)
   05211 Renal cell carcinoma
    104659700 (BRAF)
   05219 Bladder cancer
    104659700 (BRAF)
   05215 Prostate cancer
    104659700 (BRAF)
   05213 Endometrial cancer
    104659700 (BRAF)
   05224 Breast cancer
    104659700 (BRAF)
   05223 Non-small cell lung cancer
    104659700 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104659700 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    104659700 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    104659700 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104659700 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104659700 (BRAF)
   05160 Hepatitis C
    104659700 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104659700 (BRAF)
   01522 Endocrine resistance
    104659700 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104659700 (BRAF)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104659700 (BRAF)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104659700 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 104659700
NCBI-ProteinID: XP_010358114
LinkDB
Position
6
AA seq 762 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAAASSAADPAVPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEYLGNGTDFSVSSSASMDTVTSSS
SSSLSVLQSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKAL
MMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTL
AFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEA
SLAETALTSGSSPSAPTSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSS
APNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKML
NVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWS
GSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQI
IFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIH
RSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccctgccgttccg
gaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcccta
ttggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaa
tacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatatctgggg
aacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatcttcttcc
tcttctagcctttcagtgctacaatctctttcagtttttcaaaatcccacagatgtggca
cggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctacccaacaaacag
aggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaagaaagcactg
atgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaag
aaaccaattggctgggacactgatatttcctggcttactggagaagaattgcatgtggaa
gtgttggagaatgttccacttacaacacacaactttgtacgaaaaacatttttcacctta
gcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgtggt
tataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaa
cttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaagaggcc
tccttagcagagactgccctaacatctggatcatccccttccgcacccacctcagactct
attgggccccaaattctcaccagtccgtctccttcaaaatccattccaattccacagccc
ttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccggtcctcatca
gctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttgattagagac
caaggatttcgtggtgatggaggatcaaccacaggtttgtctgccaccccccctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcgagaa
aggaagtcatcttcatcctcagaagacaggaatcggatgaaaacacttggtagacgggac
tcgagtgatgattgggagattcctgatgggcagattacagtgggacaaagaattggatct
gggtcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttg
aatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagtaggagtactc
aggaaaacacgacacgtgaatatcctactcttcatgggctattccacaaagccacaacta
gctattgttacccagtggtgcgagggctccagcttgtatcaccatctccatatcattgag
accaaatttgagatgatcaaacttatagatattgcacgacagactgcacagggcatggat
tacttacacgccaagtcaatcatccacagagacctcaagagtaataatatatttcttcat
gaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatctcgatggagt
gggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagtcatc
agaatgcaagataaaaatccatacagctttcagtcggatgtatatgcctttgggattgtt
ctgtatgaattgatgactggacagttaccttattcaaacatcaataacagggaccagata
atttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagtaactgt
ccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagatgaaagacca
ctctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaattcac
cgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggattttagtcta
tatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaatttgcagcc
ttcaagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664593
Entry
104664593         CDS       T03989                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04068  FoxO signaling pathway
rro04270  Vascular smooth muscle contraction
rro04650  Natural killer cell mediated cytotoxicity
rro04720  Long-term potentiation
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04928  Parathyroid hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104664593 (ARAF)
   04012 ErbB signaling pathway
    104664593 (ARAF)
   04068 FoxO signaling pathway
    104664593 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104664593 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104664593 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104664593 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    104664593 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    104664593 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104664593 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    104664593 (ARAF)
   04720 Long-term potentiation
    104664593 (ARAF)
   04730 Long-term depression
    104664593 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664593 (ARAF)
   05205 Proteoglycans in cancer
    104664593 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104664593 (ARAF)
   05212 Pancreatic cancer
    104664593 (ARAF)
   05225 Hepatocellular carcinoma
    104664593 (ARAF)
   05226 Gastric cancer
    104664593 (ARAF)
   05214 Glioma
    104664593 (ARAF)
   05221 Acute myeloid leukemia
    104664593 (ARAF)
   05220 Chronic myeloid leukemia
    104664593 (ARAF)
   05218 Melanoma
    104664593 (ARAF)
   05211 Renal cell carcinoma
    104664593 (ARAF)
   05219 Bladder cancer
    104664593 (ARAF)
   05215 Prostate cancer
    104664593 (ARAF)
   05213 Endometrial cancer
    104664593 (ARAF)
   05224 Breast cancer
    104664593 (ARAF)
   05223 Non-small cell lung cancer
    104664593 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104664593 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    104664593 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    104664593 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104664593 (ARAF)
   05160 Hepatitis C
    104664593 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104664593 (ARAF)
   01522 Endocrine resistance
    104664593 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104664593 (ARAF)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104664593 (ARAF)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104664593 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 104664593
NCBI-ProteinID: XP_010364436
UniProt: A0A2K6RFI7
LinkDB
Position
7
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELL
TPQGPRPHTQHCDPEHFPFPVPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFS
TDAASSRGGGDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctgaaggtgcggggtctaaatcaggactgctgtgtg
gtctaccgactcatcaagggacgaaagacagtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtcgaggtccttgaagatgtcccgctgaccatgcacaat
tttgtacggaagaccttcttcagcctggcgttctgtgacttctgccttaagtttctgttc
catggcttccgttgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccaacagttctaccacagtgtccaggat
ttgtccggaggctccagacaacatgaggctccctcgaaccgccccctgaatgagttgcta
accccccagggtcccaggccccacactcagcactgtgacccggagcacttccccttccct
gtcccggccaacgcccccctgcagcgcatccgctccacatccactcccaacgtccatatg
gtcagcaccacggcccccatggactccaacctcatccagctcactggccagagtttcagc
actgatgctgccagtagtagaggaggtggtgatggaaccccccgggggagccccagccca
gccagcgtgtcctcggggaggaaatccccacattccaagtcaccagcagagcagcgtgag
cggaagtccttggccgatgacaagaagaaagtgaagaacctggggtaccgggactcaggc
tattactgggaggtaccacccagtgaggtgcagctgctgaagaggatcgggacgggctcg
tttggcaccgtgtttcgagggcggtggcatggcgatgtggctgtgaaggtgctcaaggtg
tcccagcccaccgctgagcaggcccaagctttcaagaatgagatgcaggtgctcaggaag
acgcgacatgtcaacatcttgctgtttatgggcttcatgacccggccgggatttgccatc
atcacacagtggtgtgaaggctccagcctctaccatcacctgcatgtggctgacacacgc
ttcgacatggtccagctcatcgacgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctacatgagggg
ctcacggtgaagatcggtgactttggcttggccacagtgaagactcgatggagcggggcc
cagcccttggagcagccctcaggctctgtgctgtggatggcagctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcagatgtctatgcctacggggttgtgctctac
gagctcatgactggctcactgccttacagccacattggctgccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctctagcaactgccccaag
gccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggaacggcccctcttc
ccccagatcctggccacaattgagctgctgcaacggtcactccccaagattgagcggagt
gcctcggaaccctccttgcaccgcacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673299
Entry
104673299         CDS       T03989                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04613  Neutrophil extracellular trap formation
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05132  Salmonella infection
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104673299 (RAF1)
   04012 ErbB signaling pathway
    104673299 (RAF1)
   04014 Ras signaling pathway
    104673299 (RAF1)
   04015 Rap1 signaling pathway
    104673299 (RAF1)
   04370 VEGF signaling pathway
    104673299 (RAF1)
   04371 Apelin signaling pathway
    104673299 (RAF1)
   04630 JAK-STAT signaling pathway
    104673299 (RAF1)
   04068 FoxO signaling pathway
    104673299 (RAF1)
   04072 Phospholipase D signaling pathway
    104673299 (RAF1)
   04071 Sphingolipid signaling pathway
    104673299 (RAF1)
   04024 cAMP signaling pathway
    104673299 (RAF1)
   04022 cGMP-PKG signaling pathway
    104673299 (RAF1)
   04151 PI3K-Akt signaling pathway
    104673299 (RAF1)
   04150 mTOR signaling pathway
    104673299 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104673299 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    104673299 (RAF1)
   04218 Cellular senescence
    104673299 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673299 (RAF1)
   04540 Gap junction
    104673299 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104673299 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104673299 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104673299 (RAF1)
   04625 C-type lectin receptor signaling pathway
    104673299 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    104673299 (RAF1)
   04660 T cell receptor signaling pathway
    104673299 (RAF1)
   04662 B cell receptor signaling pathway
    104673299 (RAF1)
   04664 Fc epsilon RI signaling pathway
    104673299 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    104673299 (RAF1)
   04062 Chemokine signaling pathway
    104673299 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104673299 (RAF1)
   04929 GnRH secretion
    104673299 (RAF1)
   04912 GnRH signaling pathway
    104673299 (RAF1)
   04915 Estrogen signaling pathway
    104673299 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    104673299 (RAF1)
   04917 Prolactin signaling pathway
    104673299 (RAF1)
   04921 Oxytocin signaling pathway
    104673299 (RAF1)
   04926 Relaxin signaling pathway
    104673299 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    104673299 (RAF1)
   04919 Thyroid hormone signaling pathway
    104673299 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    104673299 (RAF1)
   04916 Melanogenesis
    104673299 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104673299 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    104673299 (RAF1)
   04720 Long-term potentiation
    104673299 (RAF1)
   04730 Long-term depression
    104673299 (RAF1)
   04722 Neurotrophin signaling pathway
    104673299 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    104673299 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673299 (RAF1)
   05206 MicroRNAs in cancer
    104673299 (RAF1)
   05205 Proteoglycans in cancer
    104673299 (RAF1)
   05230 Central carbon metabolism in cancer
    104673299 (RAF1)
   05231 Choline metabolism in cancer
    104673299 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104673299 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673299 (RAF1)
   05212 Pancreatic cancer
    104673299 (RAF1)
   05225 Hepatocellular carcinoma
    104673299 (RAF1)
   05226 Gastric cancer
    104673299 (RAF1)
   05214 Glioma
    104673299 (RAF1)
   05221 Acute myeloid leukemia
    104673299 (RAF1)
   05220 Chronic myeloid leukemia
    104673299 (RAF1)
   05218 Melanoma
    104673299 (RAF1)
   05211 Renal cell carcinoma
    104673299 (RAF1)
   05219 Bladder cancer
    104673299 (RAF1)
   05215 Prostate cancer
    104673299 (RAF1)
   05213 Endometrial cancer
    104673299 (RAF1)
   05224 Breast cancer
    104673299 (RAF1)
   05223 Non-small cell lung cancer
    104673299 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104673299 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    104673299 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    104673299 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104673299 (RAF1)
   05152 Tuberculosis
    104673299 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104673299 (RAF1)
   05161 Hepatitis B
    104673299 (RAF1)
   05160 Hepatitis C
    104673299 (RAF1)
   05164 Influenza A
    104673299 (RAF1)
   05163 Human cytomegalovirus infection
    104673299 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104673299 (RAF1)
   05165 Human papillomavirus infection
    104673299 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104673299 (RAF1)
   01522 Endocrine resistance
    104673299 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104673299 (RAF1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104673299 (RAF1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   104673299 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 104673299
NCBI-ProteinID: XP_010375599
UniProt: A0A2K6R7G0
LinkDB
Position
1
AA seq 668 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTLVQQFGYQRRASDDGKLTDASKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNNLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVNPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggattcaaagatgcc
gtgtttgatggctccagctgcatctctcctacattagttcagcagtttggctatcagcgc
cgggcatcagatgatggcaaactcacagatgcttctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggccttcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgcttagattggaatactgatgctgcctct
ttgattggggaagaacttcaagtagatttcctggatcatgttccgcttacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcaaacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgtttccaaattccact
attggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtct
gtttccaggatgcctgttagttctcagcacaggtattctacacctcacgccttcaccttt
aacacctccagtccctcatctgaaggttccctgtcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgagaataac
aacctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctg
agcccaacaggctggtcacagccgaaaacacccgtgccagcacaaagagagcgggcacca
gtatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctgtccactcggattgggtcaggctctttt
ggaactgtttataagggcaaatggcatggagacgttgcagtaaagatcctaaaggttgtc
aacccaaccccagagcaattccaggccttcaggaatgaggtggctgttctgcgcaaaaca
cggcatgtgaacattctgcttttcatggggtacatgacaaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttt
cagatgttccagctaattgacattgcccgacagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacctactggctctgtcctgtggatggccccagaggtgatccgaatgcag
gataacaacccattcagtttccagtcggatgtctactcctatggcatcgtattatatgag
ctgatgacgggggaacttccttactctcacatcaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcctccccagatcttagtaagctatataagaactgccccaaagca
atgaagaggctggtagctgactgtgtgaagaaagtaaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaagatcaaccggagcgct
tccgagccatccttgcatcgggcagcccacactgaggatatcaatgcttgcacgctgacc
acgtcccctaggctgcctgtcttctag

DBGET integrated database retrieval system