KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659721Help
Entry
104659721         CDS       T03989                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00052  Galactose metabolism
rro00500  Starch and sucrose metabolism
rro01100  Metabolic pathways
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104659721 (MGAM)
   00500 Starch and sucrose metabolism
    104659721 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104659721 (MGAM)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104659721 (MGAM)
    3.2.1.20  alpha-glucosidase
     104659721 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104659721
NCBI-ProteinID: XP_010358137
LinkDB All DBs
Position
Un
AA seq 1321 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISTVLIVLLAKESLKSTAPDPGTTDPPDPGTTGST
QPRTTGPLDPGTTGTTPISAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTAQLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTNNRFEVPHEHVQSFSGNAAASLTYQVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
DQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYQYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYTMAVATAEAAKTVFPNKRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVIAYVPGAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPGNVTVKHNGVPRQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSIYAN
AFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPRVPSSTPEGQLYDVLIK
KNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILVSPDVNVCGQFG
S
NT seq 3965 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtactgttctaattgtgcttttagccaaagagtcattgaaa
tcaacagccccagatcccgggacaactgatcccccagatcctggaacaactggttccacg
cagcctaggacaacgggtcccctagatcctggaacaactggtaccactcctatttctgct
gaatgtccagtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtgagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccagttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccaataacaggtttgaagtaccccatgaacatgtgcagtcctttagtggaaat
gctgctgcttctttgacctaccaagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
gaccagttcttgcagctctccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaacagg
gacacaactcccaatggaaatggaactaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccattgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctactgggcacttggatttcacctcagtcgttatcaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcaatgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtacgacgttcacaatctgtatggctac
accatggcggttgccacagcagaagctgccaagactgtgttccctaataagagaagcttc
attctgacccgttctacctttgcgggctctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacttgcgatggtccatccctggcgtgcttgagttcaacctt
tttggcatcccaatggtgggtcctgacatatgtggttttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggtgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctattgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggctaggccccttttgcatgagttctacgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatagcatatgtgcctggtgctgtctggtatgac
tacgagactgggaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctggtaatgttacagtgaaacacaatggtgtgccacgtcagacttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatattgatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggtgcttctgcagaaaactgcactgcccgtggctgtatctgggaggcatcc
aattcttctggagtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatataattcacatggggccacagctgacatctccttaaagtcttccatttatgccaat
gccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccagggtgccatccagcacccctgagggtcaactctatgatgtcctcattaag
aagaatccatttgggattgaaattcgccgcaagagtacaggcactataatttgggactct
cagctccttggcttcaccttcaatgacatgtttatccgcatctccacccgccttccctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggacggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcaa
tacactgagttgattggccggcctgtgatggtaccttactggtctttaggtttccagctg
tgtcgctatggataccagaatgactctgagatcgccagcttgtatgatgagatggtggcc
gcgcagatcccttatgatgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgat
gggatgcgggtcatcctcattctggttagtcctgatgtgaatgtgtgcggtcagtttggg
agcag

DBGET integrated database retrieval system