KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659731
Entry
104659731         CDS       T03989                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1 isoform X2
  KO
K04490  transcription factor 7-like 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05132  Salmonella infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104659731 (TCF7L1)
   04390 Hippo signaling pathway
    104659731 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104659731 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104659731 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659731 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104659731 (TCF7L1)
   05225 Hepatocellular carcinoma
    104659731 (TCF7L1)
   05226 Gastric cancer
    104659731 (TCF7L1)
   05216 Thyroid cancer
    104659731 (TCF7L1)
   05221 Acute myeloid leukemia
    104659731 (TCF7L1)
   05217 Basal cell carcinoma
    104659731 (TCF7L1)
   05215 Prostate cancer
    104659731 (TCF7L1)
   05213 Endometrial cancer
    104659731 (TCF7L1)
   05224 Breast cancer
    104659731 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104659731 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104659731 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104659731 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104659731 (TCF7L1)
   05165 Human papillomavirus infection
    104659731 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104659731 (TCF7L1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    104659731 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 104659731
NCBI-ProteinID: XP_010358145
LinkDB
Position
17
AA seq 589 aa
MPQLGGGGGGGGGGGSGGGSGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQ
RDLDEVKSSLVNESENQSSSSDSEAERRPQPARDTFQKPRDYFAEVRRPQDSAFFKGPPY
PGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKV
PVVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPDIDPKTGIPRPPHPSELSPYYPLSPG
AVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPG
LPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKE
MRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNY
GKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSP
ATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQP
PLLSRPLPLGSMPTALLASPPSFPTTLHAHQALPVLQAQPLSLVTKSAH
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcgggggcggcggcggcggcagcgggggaggcagt
ggctccagcgccggggcggcaggcggaggggacgacctcggggcgaacgacgagctgatc
cccttccaggatgaggggggcgaggagcaggagccgagcagcgacagcgcctcggcgcag
cgggacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagc
tccgactcggaggctgagaggcgcccgcagcccgcccgggacactttccagaagccgcgg
gactatttcgccgaagtgagaaggccccaggacagcgcgttctttaaaggacccccatac
cctgggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggaccc
ctgtctcccggaggagcgcgcacctacctgcagatgaagtggcccctcctcgatgtcccc
tccagcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagtt
cctgtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaat
gaccacttctcccccggctcccctcccacccacctctccccagatattgatccaaagaca
ggaatcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccgga
gctgtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatg
tactcccttcctcctggtggcttccggcacccttaccccgccctcgccatgaacgcctcg
atgtccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggc
ctgcccacctcagggatcccccaccctgccatcgtctcccccattgtcaagcaggaaccg
gcaccccccagcctgagccctgcagtgagcgcgaaatcaccagtcaccgtgaaaaaggag
gaagaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggag
atgagagccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatc
ctgggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcc
cggaaggagcggcagcttcactcgcagctctacccgacctggtcagcgcgggacaactac
ggtaagaaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaa
gtccaggaggcagagggtgctctggcctccaagagcaagaagccatgtgttcagtacctg
ccccccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactcccca
gccaccccctctgcagcgctggcctcaccagctgccccggctgccacccattcggagcaa
gcccagcccctctccctcaccactaaaccagaaacccgggcccagctggctctccactct
gctgccttcttgtcagctaaggctgcagcctcctcctctggccagatgggcagccagcct
cccctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctccc
ccgtcctttcccaccacactccatgcccaccaggccctcccggtgctacaggcccagcct
ctttccctggtcaccaagtctgcccactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659811
Entry
104659811         CDS       T03989                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X9
  KO
K02620  transcription factor 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05132  Salmonella infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104659811 (TCF7)
   04390 Hippo signaling pathway
    104659811 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104659811 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    104659811 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104659811 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659811 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104659811 (TCF7)
   05225 Hepatocellular carcinoma
    104659811 (TCF7)
   05226 Gastric cancer
    104659811 (TCF7)
   05216 Thyroid cancer
    104659811 (TCF7)
   05221 Acute myeloid leukemia
    104659811 (TCF7)
   05217 Basal cell carcinoma
    104659811 (TCF7)
   05215 Prostate cancer
    104659811 (TCF7)
   05213 Endometrial cancer
    104659811 (TCF7)
   05224 Breast cancer
    104659811 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104659811 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104659811 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104659811 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104659811 (TCF7)
   05165 Human papillomavirus infection
    104659811 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104659811 (TCF7)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    104659811 (TCF7)
SSDB
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 104659811
NCBI-ProteinID: XP_010358253
LinkDB
Position
3
AA seq 280 aa
MYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQAPHGVPQLSLYEHFNSPHPTPAP
ADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSSVPGHPAAIPHPA
IVPPSGKQELQSFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKE
SAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQE
STTETNWPRELKDGNGQEESLSMSSSLAQPEDWDGWARKP
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtacaaagagaccgtctactccgccttcaatctgctcatgcactacccacccccctcg
ggagcagggcagcacccccagccgcagcccccgctgcacaaggccaatcaggccccccat
ggtgtcccccaactctctctctacgaacatttcaacagcccacaccccacccctgcacct
gcggacatcagccagaagcaagttcacaggcctctgcagacccctgacctctctggcttc
tactccctgacctcaggcagcatggggcagctcccccacactgtgagctggttcacccac
ccgtccttgatgctaggttccagtgtacctggtcacccagcagccatcccccacccggcc
attgtgcccccctcagggaagcaggagcttcagtccttcgaccgcaacctgaagacacaa
gcagagtccaaagcagagaaggaggccaagaagccaaccatcaagaagcccctcaatgcc
ttcatgctgtatatgaaggagatgagagccaaagtcattgcagagtgcacgcttaaggag
agtgctgccatcaaccagatcctgggccgcaggtggcatgcgctgtcgcgagaagagcag
gccaagtactatgagctggcccgcaaggagaggcagctgcacatgcagctatacccaggc
tggtcagcacgggacaactacgggaagaagaagaggcggtcgagggaaaagcaccaagaa
tccaccacagagacaaactggcccagagaactcaaggatggtaatggacaagaagagtca
ctgtccatgtcttcttctctagcccaacctgaggactgggatggctgggcaaggaagcca
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664436
Entry
104664436         CDS       T03989                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05132  Salmonella infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104664436 (TCF7L2)
   04390 Hippo signaling pathway
    104664436 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104664436 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104664436 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664436 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104664436 (TCF7L2)
   05225 Hepatocellular carcinoma
    104664436 (TCF7L2)
   05226 Gastric cancer
    104664436 (TCF7L2)
   05216 Thyroid cancer
    104664436 (TCF7L2)
   05221 Acute myeloid leukemia
    104664436 (TCF7L2)
   05217 Basal cell carcinoma
    104664436 (TCF7L2)
   05215 Prostate cancer
    104664436 (TCF7L2)
   05213 Endometrial cancer
    104664436 (TCF7L2)
   05224 Breast cancer
    104664436 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104664436 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104664436 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104664436 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104664436 (TCF7L2)
   05165 Human papillomavirus infection
    104664436 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104664436 (TCF7L2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    104664436 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 104664436
NCBI-ProteinID: XP_030796766
LinkDB
Position
11
AA seq 671 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCIESNKVPVVQH
PHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQI
PHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTTG
IPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKV
VAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKK
RKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVR
YIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSM
MPPPPALLLTEATHKASTLCPNGALDLPPTALQPAAPSSSVAQPSTSSLHSHSSLAGTQP
QPLSLVTKSLE
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctgcagagtagacaagccctcaaggatgcccggtccccatcgccg
gcacacattgtcagccccctcccttgctgcactcagggacatgactgtcagcacttctac
cccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccactcc
ttacaaaaagttggggagccctggtgtattgagtcgaacaaagtgccagtggtgcagcac
cctcaccatgtccaccccctcacgcctcttatcacgtacagcaatgaacacttcacgccg
ggaaacccacctccacacttaccagccgacgtagaccccaaaacaggaatcccacggcct
ccgcaccctccagatatatccccgtattacccgctatcgcctggcaccgtaggacaaatc
ccccatccgctaggatggttagtaccacagcaaggtcaaccagtgtacccaatcacaaca
ggaggattcagacacccctaccccacagctctgactgtcaatgcttccatgtccagcttt
ctgtcttctaggttccctccccatatggtcccaccacatcatacgctacacacgacgggc
attccgcatccggccatagtcacaccaacagtcaaacaggaatcttcccagagtgacgtc
ggctcactccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaagccc
cacataaagaaacctcttaatgcattcatgttgtatatgaaggaaatgagagcaaaggtc
gtagctgagtgcacgttgaaagaaagcgcggccatcaaccagatccttgggcggaggtgg
cacgcactgtccagagaagagcaagcgaaatactatgagctggcccggaaggagcgacag
cttcatatgcagctgtaccccggctggtctgcgcgggataactatggaaagaagaagaag
aggaaaagggacaagcagccgggagagaccaatgaacacagcgaatgtttcctaaatcct
tgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgcttt
ggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgttcgc
tacatacaaggtgaaggcagctgcctcagcccaccctcttcagatggaagcttactagat
tcgcctcccccctcccccaacctgctaggctcccctccccgagacgccaagtcacagact
gagcagacccagcctctgtcgctgtccctgaagcccgaccccctggcccacctgtccatg
atgcctccgccgcccgccctcctgctcaccgaggccacccacaaggcctccaccctctgt
cccaacggggccctggacctgcccccaaccgctttgcagcctgccgccccctcctcatca
gttgcacagccgtcaacttcttccttacattcccacagctccctggccgggacccagccc
cagccgctgtcgctcgtcaccaagtctttagaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670045
Entry
104670045         CDS       T03989                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05132  Salmonella infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104670045 (LEF1)
   04390 Hippo signaling pathway
    104670045 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104670045 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104670045 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670045 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104670045 (LEF1)
   05225 Hepatocellular carcinoma
    104670045 (LEF1)
   05226 Gastric cancer
    104670045 (LEF1)
   05216 Thyroid cancer
    104670045 (LEF1)
   05221 Acute myeloid leukemia
    104670045 (LEF1)
   05217 Basal cell carcinoma
    104670045 (LEF1)
   05215 Prostate cancer
    104670045 (LEF1)
   05213 Endometrial cancer
    104670045 (LEF1)
   05224 Breast cancer
    104670045 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670045 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104670045 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104670045 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670045 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104670045 (LEF1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    104670045 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 104670045
NCBI-ProteinID: XP_010371503
LinkDB
Position
2
AA seq 414 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccact
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcaccctgaagaggaaggcgatttagctgacatcaagtcctctttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgatggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccctgtct
ccgggtggtgttggacagatcaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggtggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcatatgattcccggtcctcctgggccccacacaactggcatccctcat
ccagctattgtaacacctcaggtcaaacaggaacatccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtcgctgag
tgtactctaaaagaaagtgcagctatcaaccagattcttggcagaaggtggcatgccctc
tcccgtgaagagcaggctaaatattatgaattagcacggaaagaaagacagctacatatg
caactttatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctacatcaggtggaaaacgaagctcattcccaacgtgtaaagcc
aaggcagcgaccccaggacctcttctggagatggaagcttgttga

DBGET integrated database retrieval system