KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659834
Entry
104659834         CDS       T03989                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04672  Intestinal immune network for IgA production
rro05140  Leishmaniasis
rro05200  Pathways in cancer
rro05310  Asthma
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659834 (IL4)
   04151 PI3K-Akt signaling pathway
    104659834 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659834 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659834 (IL4)
   04660 T cell receptor signaling pathway
    104659834 (IL4)
   04658 Th1 and Th2 cell differentiation
    104659834 (IL4)
   04659 Th17 cell differentiation
    104659834 (IL4)
   04657 IL-17 signaling pathway
    104659834 (IL4)
   04664 Fc epsilon RI signaling pathway
    104659834 (IL4)
   04672 Intestinal immune network for IgA production
    104659834 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659834 (IL4)
  09163 Immune disease
   05310 Asthma
    104659834 (IL4)
   05320 Autoimmune thyroid disease
    104659834 (IL4)
   05321 Inflammatory bowel disease
    104659834 (IL4)
   05330 Allograft rejection
    104659834 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104659834 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659834 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659834 (IL4)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659834 (IL4)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Haparin
  Cytokines
   104659834 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Mannosyl_trans3
Other DBs
NCBI-GeneID: 104659834
NCBI-ProteinID: XP_010358290
UniProt: A0A2K6RBZ7
LinkDB
Position
3
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHNCHNALREIIETLNSLTEQKTLCTELTVTDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaactgccataacgccttacgggagatcatcgaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgatccgattcctgaaacggctggacaggaacctctggggcctggcaggcttg
aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system