KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104659849
Entry
104659849         CDS       T03989                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04664  Fc epsilon RI signaling pathway
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05221  Acute myeloid leukemia
rro05310  Asthma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104659849 (IL3)
   04151 PI3K-Akt signaling pathway
    104659849 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104659849 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104659849 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104659849 (IL3)
   04664 Fc epsilon RI signaling pathway
    104659849 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104659849 (IL3)
   05202 Transcriptional misregulation in cancer
    104659849 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104659849 (IL3)
  09163 Immune disease
   05310 Asthma
    104659849 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104659849 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104659849 (IL3)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104659849 (IL3)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Haparin
  Cytokines
   104659849 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 104659849
NCBI-ProteinID: XP_010358314
LinkDB
Position
3
AA seq 143 aa
MSRLPILLLLHLLVSPGLQAPMTQTTSLKTSWANCSNMIDEIITHLKQPPLPSSDFNNLS
GEDQAILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRHPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccatcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaactgctctaacatgatcgat
gaaatcataacacacttaaaacagccacctttgccttcgtcggacttcaacaacctcagt
ggggaagaccaagccattctggtggaaaaaaatcttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaatgcatcagcaatcgagagcattcttaagaatctc
ccgccatgcctgcccatggccacggccgcacccacgcgacatccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctacctgaaaacccttgagaatgag
caggctcaatag

DBGET integrated database retrieval system