KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660035
Entry
104660035         CDS       T03989                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104660035 (PRKAG3)
   04068 FoxO signaling pathway
    104660035 (PRKAG3)
   04152 AMPK signaling pathway
    104660035 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104660035 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104660035 (PRKAG3)
   04922 Glucagon signaling pathway
    104660035 (PRKAG3)
   04920 Adipocytokine signaling pathway
    104660035 (PRKAG3)
   04921 Oxytocin signaling pathway
    104660035 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    104660035 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    104660035 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104660035 (PRKAG3)
   04714 Thermogenesis
    104660035 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104660035 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104660035 (PRKAG3)
   04931 Insulin resistance
    104660035 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 104660035
NCBI-ProteinID: XP_010358557
UniProt: A0A2K6PDP7
LinkDB
Position
14
AA seq 489 aa
MEPELEHALHRTPSWSSLGGSEHQEMSFLEQEDSSSWPSPAVTSSSERIRRKRRAKSSRW
TRQEAVKEGEPPGQGQGPWSRPAAESTGLEATFPKAAPLAQADPARVGTPPTGWDCLPSD
CIASATGSSTDEVELATEFPATEAWQYELEGLVEERPAPCPSPQALFPKLGWDDELQKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAQEQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggagccagagctggaacacgcactgcacaggaccccttcctggagcagccttgggggt
tctgagcatcaagagatgagcttcctagagcaagaagacagcagctcatggccatcacca
gctgtgaccagcagctcagaaagaatccgcaggaaacggagggccaagtcctcgagatgg
acaaggcaggaggcagtgaaggaaggggagccaccgggtcaggggcaaggtccctggtcc
aggccagctgctgagtccaccgggctggaggccacattccctaaggccgcacccttggct
caagctgatcctgccagagtaggcactccaccaacagggtgggactgcctcccctctgac
tgtatagcctcagctacaggctccagcacagatgaagtggagctggccacggagttccca
gccacagaggcctggcagtatgagctagaaggcctggttgaagagaggcctgccccatgc
ccgtccccacaagccctgtttcccaagctgggctgggatgacgaactgcagaaacctggc
gcccagatctacatgcgcttcatgcaggagcacacctgctatgatgccatggcaactagc
tccaagctggtcatcttcgacaccacgctggagatcaagaaggccttctttgctctggtg
gccaacggtgtgcgggcagcccctctgtgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtcccccctggtccag
atctatgagattgaacaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtctccatctctcctaatgacagcctgtttgaagctgtctacaccctc
atcaagaaccggatccatcgcctgcctgttctggacccggtgtcaggcaacgtactccac
atcctcacgcacaaacgcctgctcaagttcctgcacatctttggttccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacattccgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggatcggcgtgtg
tctgcactgcctgtggtcaacgaatgtggtcaggtcgtgggactctattcccgctttgat
gtgatccacctggctgcccagcaaacctacaaccacctggacatgagtgtgggagaagct
ctgaggcagaggacactatgtctggagggagtcctttcctgccaaccccatgagagcttg
ggggaagtgatcgacaggattgctcaggagcaggtacaccggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcatcgatgccctcggggcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678710
Entry
104678710         CDS       T03989                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104678710 (PRKAG2)
   04068 FoxO signaling pathway
    104678710 (PRKAG2)
   04152 AMPK signaling pathway
    104678710 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104678710 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104678710 (PRKAG2)
   04922 Glucagon signaling pathway
    104678710 (PRKAG2)
   04920 Adipocytokine signaling pathway
    104678710 (PRKAG2)
   04921 Oxytocin signaling pathway
    104678710 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    104678710 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    104678710 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104678710 (PRKAG2)
   04714 Thermogenesis
    104678710 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104678710 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104678710 (PRKAG2)
   04931 Insulin resistance
    104678710 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 104678710
NCBI-ProteinID: XP_010382349
UniProt: A0A2K6P447
LinkDB
Position
6
AA seq 444 aa
MRRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEP
ERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAAPGPAEAGMLE
KLEFEDEAEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAP
LWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNIS
PDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNL
DELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEK
TYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGII
SLSDILQALILTPAGAKQKETETE
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgaggcgctttgggagtctcaggagcaacaagaaacacaaggaccaaaatcgaagcacg
gagaggcgccagtcggagccccatggccttttcgcctccggcctctcctcctctccgtca
acacccacccaagtgaccaagcagcacacatttcccctggaatcctataagcacgagcct
gaacggttagagaatcgcatctatgcctcgtcttcccctccggatacagggcagaggttc
tgcccgtcttccttccagagcccgaccaggcctccactggcatcaccgacacactatgct
ccctccaaagccgcggcgctggcggcggccccgggacccgcggaagccggcatgctggag
aagctggagttcgaggacgaagcagaagactcagaaagtggtgtttacatgcgattcatg
aggtcacacaagtgttatgacatcgttccaaccagttcaaagcttgtcgtctttgatact
acattacaagttaaaaaggccttctttgctttggtagccaacggtgtccgagcagcgcca
ctgtgggagagtaaaaaacaaagttttgtaggaatgctaacaattacagatttcataaat
atactacatagatactataaatcgcctatggtacagatttatgaattagaggaacataaa
attgaaacctggagggagctttatttacaagaaacatttaagcctttagtgaatatatct
ccagatgcaagcctcttcgatgctgtatactccttgatcaaaaataaaatccacagattg
ccagttattgaccctatcagtgggaatgcactttatatactcacccacaaaagaatcctc
aagttcctccagctttttatgtctgatatgccaaagcctgccttcatgaagcagaacctg
gatgagcttggaataggaacataccacaacattgccttcatacatccagacactcccatc
attaaagccttgaacatatttgtggaaagacgaatatcagctctgcctgttgtggatgag
tcaggaaaagttgtagatatttattccaaatttgatgtaattaatcttgctgctgagaaa
acgtacaataacctagatatcacagtgacccaggctcttcagcaccgttcacagtatttt
gaaggtgttgtgaagtgcaataagctggaaatactggagaccattgtggacagaatagtg
agagctgaggtccatcggctggtggtggtaaatgaagcagatagtatcgtgggtattatt
tccctgtcggatattctgcaagccctgatcctcacaccagcaggtgccaaacaaaaggag
acggaaacagagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679727
Entry
104679727         CDS       T03989                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04710  Circadian rhythm
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104679727 (PRKAG1)
   04068 FoxO signaling pathway
    104679727 (PRKAG1)
   04152 AMPK signaling pathway
    104679727 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104679727 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104679727 (PRKAG1)
   04922 Glucagon signaling pathway
    104679727 (PRKAG1)
   04920 Adipocytokine signaling pathway
    104679727 (PRKAG1)
   04921 Oxytocin signaling pathway
    104679727 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    104679727 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    104679727 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104679727 (PRKAG1)
   04714 Thermogenesis
    104679727 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104679727 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104679727 (PRKAG1)
   04931 Insulin resistance
    104679727 (PRKAG1)
SSDB
Motif
Pfam: CBS Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 104679727
NCBI-ProteinID: XP_010383720
UniProt: A0A2K6QG99
LinkDB
Position
10
AA seq 331 aa
METVISSDSSPALENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagacggtcatttcttcagatagctccccagctctggaaaatgagcatcctcaagag
accccagaatccaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacgtccctgcaggtgaagaaagct
ttttttgctttggtgactaacggtgtacgagctgcccctttatgggatagtaagaagcaa
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgctactataaa
tcagccttggtacagatctatgagctagaagaacacaagatagaaacttggagagaggtg
tacctccaggattcctttaaaccgcttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcggaacaagatccacaggctgccagttattgacccagaatca
ggcaatactttgtatatcctcacccacaagcgcattctgaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtccaagtctctggaagagctacagattggcacc
tatgccaatattgctatggttcgcactaccacccccgtctatgtggctctggggattttt
gtacagcatcgagtctcagccttgccagtggtggatgagaaggggcgtgtggtggacatc
tactccaagtttgatgttatcaatctagcagcagaaaagacttacaacaacctagatgtg
tctgtgactaaagctctgcaacatcgatcacattactttgagggtgttctcaagtgctac
ctgcatgagactctggagaccatcatcaacaggctagtggaagcagaggttcaccgactt
gtagtggtggatgaaaatgatgtggtcaagggaattgtatcactgtctgacatcctgcag
gccctggtgctcacaggtggagagaagaagccctga

DBGET integrated database retrieval system