KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660062
Entry
104660062         CDS       T03989                                 

Gene name
DES
Definition
(RefSeq) desmin
  KO
K07610  desmin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104660062 (DES)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104660062 (DES)
   05414 Dilated cardiomyopathy
    104660062 (DES)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104660062 (DES)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     104660062 (DES)
SSDB
Motif
Pfam: Filament Filament_head Spc7 GAS DUF4515 Baculo_PEP_C Trimer_CC TPR_MLP1_2 Jnk-SapK_ap_N DUF1664 TolA_bind_tri KASH_CCD Patched Prefoldin CENP-F_leu_zip Golgin_A5 CENP-H TACC_C
Other DBs
NCBI-GeneID: 104660062
NCBI-ProteinID: XP_010358612
UniProt: A0A2K6PHA2
LinkDB
Position
14
AA seq 470 aa
MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTS
GGAGGLGSLRASRLGTTRAPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFA
NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVER
DNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLK
KVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKV
SDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEA
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPI
QTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgagccaggcctactcgtccagccagcgcgtgtcctcctaccgccgcaccttcggcggg
gctccgggcttcccgctcggctccccgctgagctcgcccgtgttcccgcgggcgggcttc
ggctctaagggctcctccagctcggtgacgtcccgcgtgtaccaggtgtcgcgcacgtcg
ggcggggccgggggcctggggtcgctgcgggccagccggctggggaccactcgcgcgccc
tcctcctatggcgcgggcgagctgctggacttctctctggccgacgcggtgaaccaggag
tttctgaccacgcgcaccaacgagaaggtggagctgcaggaactcaacgaccgcttcgcc
aactacatcgagaaggtgcgcttcctggagcagcagaacgcggcgctcgcagccgaggtg
aaccggctcaagggccgcgagccgacgcgagtggccgagctctacgaggaggagctgcgc
gagctgcggcgccaggtggaggtgctcactaaccagcgcgcccgcgtcgacgtcgagcgc
gacaacctgctcgacgacctgcagcggctcaaggccaagctgcaggaggagattcagttg
aaagaagaagcagagaacaatttggctgccttccgagcggacgtggatgcagctactcta
gctcgcattgacctggagcgcagaatcgaatctctcaacgaggagatcgcgttccttaag
aaagtgcacgaagaggagatccgtgagttgcaggctcagcttcaggaacagcaggtccag
gtggagatggacatgtctaagccagacctcactgccgccctcagggacatccgggctcag
tatgagactatcgcggctaagaacatttctgaagctgaggagtggtacaagtcgaaggtg
tcagacctgacccaggcagccaacaagaacaacgatgccctgcgccaggccaagcaggag
atgatggaataccgacaccagatccagtcctacacctgcgagattgatgccctcaagggc
actaacgattccctgatgaggcagatgcgggaactggaggaccgatttgccagtgaggcc
agtggctaccaggacaacattgcgcgcctggaggaggaaatccggcacctcaaggatgag
atggcccgccacctgcgcgagtaccaggacctgctcaatgtgaagatggccctggatgtg
gagatcgccacctaccggaagctgctggagggagaggagagccggatcaatctccccatc
caaaccttctctgccctcaacttccgagaaaccagccctgagcaaaggggttctgaggtt
cataccaagaagacggtgatgatcaagaccatcgagacacgggatggggaggttgtcagt
gaggccacacagcagcagcatgaagtgctctaa

DBGET integrated database retrieval system