KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660209
Entry
104660209         CDS       T03989                                 

Gene name
EDNRA
Definition
(RefSeq) endothelin-1 receptor isoform X1
  KO
K04197  endothelin receptor type A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04270  Vascular smooth muscle contraction
rro04924  Renin secretion
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104660209 (EDNRA)
   04024 cAMP signaling pathway
    104660209 (EDNRA)
   04022 cGMP-PKG signaling pathway
    104660209 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104660209 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104660209 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104660209 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660209 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104660209 (EDNRA)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Peptide
   Endothelin
    104660209 (EDNRA)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 104660209
NCBI-ProteinID: XP_010358814
UniProt: A0A2K6NU14
LinkDB
Position
2
AA seq 427 aa
METFCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFHGTELSLLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccttttgtctcagggcatccttttggctggcacttgttggatgtgtaatcagt
gataaccctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
catggcacagagctcagcctcctggtcaccactcatcaacccactaacttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagcttttaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agccttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcagtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtccttcatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
cttaatgctacgtcaaaattcatggagttctaccaagatgtaaaggactggtggctcttt
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgccgagaggtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaaccgtgtataatgagatggacaagaatcga
tgtgaattacttagtttcttgctgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccacaaggacagcatgaactga

DBGET integrated database retrieval system