KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660448Help
Entry
104660448         CDS       T03989                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04371  Apelin signaling pathway
rro05034  Alcoholism
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104660448 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    104660448 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    104660448 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104660448 (HDAC4)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104660448 (HDAC4)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     104660448 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 104660448
NCBI-ProteinID: XP_010359108
LinkDB All DBs
Position
Un
AA seq 1039 aa AA seqDB search
MDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQL
HEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVAS
TEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWKTQHSSLDQSSPPQSGVSTSYNHPVL
GMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDS
ACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVTREGSAAPLPLYTSPS
LPNITLGLPATGPAAGTAGQRDAERLALPTLQQRLSLFPGTHLTPYLSTSPLERDGGAAH
SPLLQHMVLLEQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRT
QSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEET
EEELREHQALLDEPYLDRLPAQKEAHAPAGVQVKQEPIESDDEEAEPPREVDPGQRQPSE
QELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVQE
PPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRK
ATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEV
HSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLL
QQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPG
VGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGG
YNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVL
QQRPNANAVRSMEKVMEIHSKYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVG
VKPAEKRPDEEPMEEEPPL
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcctggaccaccagttctcgctgcctgtagcagagcctgccctgcgggag
cagcagctacagcaggagctcctggcgctcaagcagaagcagcagatccagaggcagatc
ctcatcgccgagttccagaggcagcacgagcagctctcccggcagcacgaggcgcagctc
cacgagcacatcaagcagcagcaggagatgctggccatgaagcaccagcaggagctgcta
gaacaccagcggaagctggagaggcaccgccaggagcaggagctggagaagcagcaccgg
gagcagaagctgcagcagctcaagaacaaggagaagggcaaagagagtgccgtggccagc
acagaagtgaagatgaagttacaagaatttgtcctcaataaaaagaaggcgctggcccat
cggaatctgaaccactgcatttccagcgacccccgctactggaaaacgcagcacagttcc
cttgaccagagttctccaccccagagcggagtgtcaacctcctataaccacccagtcctg
ggaatgtacgacgccaaagatgacttccctcttaggaaaacagcttctgaaccgaatctg
aaattacggtccaggctaaagcagaaagtggccgaaagacggagcagccctctgctacgc
aggaaagacgggccagtggtcactgctctaaaaaagcgtccattggatgtcacagactcc
gcgtgcagcagcgccccaggctccggacccagctcacccaacaacagctccgggagcgtc
agcgcagagaacggcatcgcgcccgccgtccccagcatcccggcggagacgagtttggca
cacagacttgtgacgcgagaaggctcggccgctccacttcccctctacacgtcgccgtcc
ctgcccaacatcacgctgggcctgcctgccaccggccctgctgctggcacggcgggccag
cgggatgccgagagactcgcccttcccaccctccagcagcggctctcccttttccctggc
acccacctcactccctacctgagcacctcgcccttggagcgggacggaggggcagcgcac
agccctcttctgcagcacatggtcttactggagcagccgccggcacaagcgccgctcgtc
acagactggtatctttcaggcctgggagcactgcccctccacgcacagtccttggttggt
gcggaccgggtgtccccttccatccacaagctgcggcagcaccgcccgctggggcgaacc
cagtcggccccgctgccccagaatgcccaggctctgcagcacctagtcatccagcagcag
catcagcagtttctggagaaacacaagcagcagttccagcagcagcaactgcacatgaac
aagatcatcccgaaaccaagcgagccggcccggcagccagagagtcacccagaggagacg
gaggaggagctccgtgagcaccaggctctgctggacgagccctacctggaccggctgccg
gcgcagaaggaggcgcacgcaccggctggcgtgcaggtgaagcaggagcccattgagagc
gatgacgaagaggcggagcccccgcgggaggtggacccaggccagcgccagcccagtgag
caggagctgctcttcagacagcaagccctcctgctggagcagcagcggatccaccagctg
aggaactaccaggcgtccatggaggctgccggcatccccgtgtccttcggcagccacagg
cctctgtcccgggcgcagtcctcaccggcatctgccacctttcccgtgtctgtgcaggag
ccccccaccaagccaaggttcacgacaggcctcgtgtatgacacgctgatgctgaagcac
cagtgcacctgcgggagcagcagcagccaccccgagcacgccgggaggatccagagcatc
tggtcccgcctgcaggagacaggcctccggggcaaatgcgagtgcatccgcggacgcaag
gccaccctggaggagctgcagacggtgcactcggaagcccacaccctcctgtacggcaca
aaccccctcaaccggcagaaactggacagtaagaaacttctaggctcgctcgcctccgtg
ttcgtccgactcccctgcggtggtgttggggtggacagcgacaccatctggaacgaggtg
cactcggcgggggcggcccgcctggccgtgggctgtgtggtggagctggtcttcaaggtg
gccacgggggagctgaagaatggttttgctgtggtccgaccccctggacaccacgcggag
gagagcacacccatgggcttttgctactttaactccgtggccgtggcagccaagcttctg
cagcagaggttgagcgtgagcaagatcctcatcgtggactgggacgtgcaccatggaaac
gggacccagcaggctttctacagcgaccccagcgtcctgtacgtgtccctccaccgctac
gatgatgggaacttcttcccgggcagcggggctcctgacgaggtgggcacagggcccggc
gtgggtttcaatgtcaacatggctttcaccggcggcctggaccctcccatgggagacgct
gagtacttggcagccttcagaacggtggtcatgccgatcgccagcgagtttgccccggac
gtggtgttggtgtcatcgggcttcgacgccgtggagggccaccccacacctctcgggggc
tacaacctctctgccagatgctttgggtacctgacgaagcagctgatgggcctggctggc
ggccggattgtcctggccctcgagggaggccacgacctgaccgccatttgcgacgcctcc
gaagcatgtgtttctgccttgctgggaaatgagcttgatcctctcccagaaaaggtttta
cagcaaagacccaatgcaaacgctgtccgctccatggagaaagtcatggaaatccacagc
aagtactggcgctgcctgcagcgtgcaacctccacggcagggcgttctctgatcgaggct
cagacttgcgagaatgaagaagccgagacggtcaccgccatggcctcgctgtccgtgggc
gtgaagcccgccgaaaagagaccagacgaggagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system