KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660552
Entry
104660552         CDS       T03989                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04110  Cell cycle
rro04360  Axon guidance
rro04722  Neurotrophin signaling pathway
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05220  Chronic myeloid leukemia
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104660552 (ABL1)
   04014 Ras signaling pathway
    104660552 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104660552 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104660552 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    104660552 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660552 (ABL1)
   05206 MicroRNAs in cancer
    104660552 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    104660552 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104660552 (ABL1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104660552 (ABL1)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  ABL family
   104660552 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 104660552
NCBI-ProteinID: XP_010359254
UniProt: A0A2K6PIM2
LinkDB
Position
16
AA seq 1149 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGIRGAVST
LLQAPELPTKTRTSRRAAEHRDATDVPEMPHSKGQGESEPLDHEPAVSPLLPRKERGPLE
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDI
SNGALALTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATG
EEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRAGENRSDQVARGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQ
VMIAPASGLPQKEEAGKGSALGTPAAAEPVTPTSKAGSGTPGGTSKGPAEESRIRRHKHS
SESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAGLGAKTKAASLVDAV
NSDAAKPSQPGEGLKKPVLPATPKPQSTKPSGTPISPAPVPSTLPSASSALAGDQPSSTA
FIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGK
NLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSV
KEISDIVQR
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagcttgcctgccctg
cattttatcaaaggagcagggaagaaggaatcatcgaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagcggccagtagcatctgactttgagcctcagggt
ctaagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaaaat
gaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgcgtcttaggctataatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaacagt
ctggagaaacactcctggtaccatgggcctgtgtcccgcaatgccgctgagtatctgctg
agcagcgggatcaatggcagcttcttggtgcgggagagtgagagcagtcctggccagagg
tccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcatcat
cattcgacagtggccgacgggctcatcaccacgctccattatccagcccccaagcgcaac
aagcccaccgtctacggtgtgtcccccaactatgacaagtgggagatggaacgcacggac
atcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggtgtgtgg
aagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtacagctc
cttggggtctgcacccgggagcccccgttctatatcatcaccgagttcatgacctacggg
aacctgctggactacctgagggagtgcaaccggcaggaggtgaatgctgtggtgctactg
tacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagctgat
tttggcctgagcaggttgatgacaggggacacctacacagcccatgccggagccaagttc
cccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtccgac
gtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttacccg
ggaattgacctgtcccaggtgtatgagctgctggagaaggactaccgcatggagcgccca
gaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatccagt
atctcagacgaagtggaaaaggagctggggaaacaaggcatccgtggggctgtgagtacc
ttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcggagcac
agagacgccaccgacgtgcctgagatgcctcactccaagggccagggagagagcgagcct
ctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccctggag
ggcggcctgaatgaagatgaacgccttctccccaaagacaaaaagaccaacttgttcagc
gccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagtagctccttc
cgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagacatc
agcaatggggcgctggctctcacccctttggacacagctgacccagccaagtccccaaag
cccagcaatggggctggggtccccaatggagccctccgggagtctgggggctcaggcttt
cggtctccccacctgtggaagaagtctagcacgctgaccagcagtcgcctagccactggc
gaggaggagggtggtggcagctccagcaagcgcttcctgcgctcctgctccgcctcctgc
gttccccacggggccaaggacacagagtggaggtcagtcacgctgcctcgggacttgcag
tctacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccggct
ctgcctcggaagagggcaggggagaacaggtctgaccaggtggcccgaggcacagtaacg
cccccacccaggctggtgaaaaagaacgaggaagctgctgatgaggtcttcaaagacatc
atggagtccagcccgggctccagcccgcccaacttgactccaaaacccctccggcggcag
gtcatgatcgcccctgcctcgggcctcccccaaaaggaagaagctggaaagggcagtgcc
ttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggtaca
ccaggaggcaccagcaagggccccgccgaggagtccagaataaggaggcacaagcactcc
tctgagtcaccagggagggacaaggggaaattgtccaggctcaaacctgccccaccgccc
ccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccaggag
gcggctggggaagcaggcctgggtgcaaagacaaaagccgccagtctggttgatgctgtg
aacagtgatgctgccaagcccagccagccaggagagggactcaaaaagcccgtgctcccg
gccactccaaagccacagtccaccaagccatcggggacccccatcagcccagcccccgtt
ccctccacgttgccgtcagcatcctcagccctggcaggggaccagccatcttccactgcc
tttatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagagcgg
atcgccagtggcgccatcaccaagggcgtggtcctagacagcaccgaggcgctgtgcctg
gccatctctaggaactcagagcagatggccagccacagtgcggtgctcgaggccggcaaa
aacctctacacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaagttt
gccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgcccg
gcgacagcaggcagtggtccggcagccactcaggacttcagcaagctcctcagttcggtg
aaggaaatcagtgacatagtgcagaggtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672008
Entry
104672008         CDS       T03989                                 

Gene name
ABL2
Definition
(RefSeq) tyrosine-protein kinase ABL2 isoform X4
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104672008 (ABL2)
   04014 Ras signaling pathway
    104672008 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104672008 (ABL2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104672008 (ABL2)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  ABL family
   104672008 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6 RGS12_us1
Other DBs
NCBI-GeneID: 104672008
NCBI-ProteinID: XP_010373984
UniProt: A0A2K6RX24
LinkDB
Position
8
AA seq 1143 aa
MVLGTVLLPPNSYGRDQDTSLCCLCTEASESALPDMTEALHRPYGCDVEPQALNEAIRWS
SKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGW
VPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGR
VYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSP
IHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVM
KEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSA
MEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPES
LAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYE
LMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILP
SKTRTLKKQVENKENIEGAQDATENSASSLTPGFIRGAQASSGSPALPRKQRDKSPSSLL
EDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQ
HADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDSGGGGGSGTAGGGWSGITGFFTPRL
IKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTV
STSSQPEENVDRANDMLPKKSEEGAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDP
PGVGVAGVAAAPKGKEKNGGTRLGMAGVLEDGEQPGWPSPAKAAPVLPTTHNHKVPVLIS
PTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHP
SICSDPTEEPTAGQSTSETQEGGKKAALGAVPVSGKAGRPVMPPPQVPLPTSSISPAKMA
NGTAGTKVALRKTKQATEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDY
CSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDV
VQR
NT seq 3432 nt   +upstreamnt  +downstreamnt
atggtccttgggacagttctccttccacctaatagttatggcagagatcaggacacctca
ctttgctgcctgtgcactgaggcctcagagtctgctctacccgacatgacagaagctttg
catcgtccctatggttgtgatgttgaaccccaggcactaaatgaagctatcaggtggagc
tccaaggagaacttgcttggagccaccgagagtgaccctaatctcttcgttgcactttat
gattttgtagcaagtggtgataacacactcagcatcactaaaggtgaaaagctacgagtt
cttggttacaaccagaatggcgagtggagtgaagttcgctctaagaatgggcagggctgg
gtgccaagcaactatatcaccccagtgaacagcctggaaaaacactcctggtaccatgga
cctgtgtcacgcagtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctg
gtgcgagaaagtgagagtagccctgggcagctgtccatctcgctcaggtacgagggacgt
gtgtatcactacaggatcaacaccaccgcagatggcaaggtatatgtgactgctgagagc
cgcttcagcaccttggcagagcttgtacaccatcactccacagtggctgatgggctggtg
acaacattacactacccagcacccaagtgtaataagcctacagtctatggtgtgtccccc
atccacgacaaatgggaaatggaacgaacggatattaccatgaagcacaaacttgggggc
ggtcagtatggagaggtttatgttggcgtctggaagaaatacagccttacagttgctgtg
aaaacactgaaggaagataccatggaggtagaagagttcctaaaagaagctgcagtaatg
aaggaaatcaagcatcctaatctggtacaacttttaggtgtctgtactttggagccaccg
ttttacattgtgactgaatacatgccatatgggaatttgctggattacctccgagaatgc
aaccgagaagaggtgactgcagttgtgcttctctacatggccactcagatttcttctgca
atggagtacttagagaagaagaattttatccatagagatcttgcagctcgtaactgccta
gtgggagaaaaccatgtggtaaaagtggctgactttggcttaagtagattgatgactgga
gacacttacactgctcatgctggagccaaatttcctattaagtggacagcaccagagagt
cttgcctacaataccttctcaattaaatctgatgtctgggcttttggagtactgttgtgg
gaaattgctacctatggaatgtcaccatatccaggtattgacctgtctcaggtctatgac
ctacttgaaaaaggatatcgaatggaacagcccgagggatgcccccctaaggtttatgaa
cttatgagagcatgctggaagtggagccctgccgacaggccctcttttgctgaaacacac
caagcttttgaaaccatgttccatgactccagcatttctgaagaggtagctgaggagctt
gggagagccgcctcctcgtcatctgttgttccgtacctgccccggctacctatacttcct
tccaagactcggacactgaagaaacaggtggagaacaaggagaacattgaaggggcacag
gatgccacagaaaattctgcttccagtttaacaccagggtttatcagaggtgcacaggcc
tccagtggatccccagcactgcctcgaaagcaaagagacaagtcacccagcagcctcttg
gaagatgccaaagagacatgcttcaccagggataggaaggggggcttcttcagctccttc
atgaaaaagagaaatgctcccacaccccccaaacgcagcagctccttccgagaaatggag
aatcagccccataagaaatacgaactcacgggtaacttctcatctgttgcttctctacag
catgctgatgggttctctttcactcctgcccagcaagaggcgaatctggtgccacccaag
tgctatggggggagctttgcacagaggaacctctgtaatgacgacagtggtgggggtggg
ggcagtggcactgctgggggtgggtggtctggcatcacaggcttctttacaccacgctta
atcaaaaagacactgggcttacgagcaggtaaacccacagccagtgatgacacttccaag
ccttttccaaggtcaaactctacatcttccatgtcctcagggcttccagagcaggatagg
atggcaatgacccttcccaggaactgccagaggtccaaactccagctggaaaggacagtg
tccacctcttctcagccagaagagaatgtggacagggccaatgacatgcttccaaaaaaa
tcagaggaaggtgctgctccaagcagggagagaccaaaagccaagttattgcccagagga
gccacagctcttcctctcagaacgccctctggggatctagccattacagagaaggaccct
ccaggggtgggagtggctggagtggcagctgcccccaagggcaaagagaagaatggtggg
acacgacttgggatggctggagttctagaggatggagagcagccaggctggccttctcca
gccaaggctgcccccgtcctcccaaccactcacaaccacaaagtgccagtccttatctca
cccactctgaaacacactccagctgacgtgcagctcattggcacagactctcaggggaat
aaattcaagctcttatctgagcatcaggtcacatcctctggagacaaggaccgaccccga
cgggtaaaaccaaagtgtgccccacccccaccaccagtgatgagactactgcagcatcca
tccatctgctcagaccctacagaagagccgactgcaggacagtccacgtcagaaacacag
gaaggaggaaagaaggcagctctgggcgcagtgcccgtcagtgggaaagctgggaggcca
gtgatgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggcc
aacggcacagcaggtactaaagtggctctgagaaaaaccaaacaggccactgagaaaatc
tcagcagacaaaatcagcaaagaggccttgctggaatgtgctgacctactgtccagtgca
atcacggaacctgtgcccaacagccagctggtagacactggacaccagctgctcgactac
tgctcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggct
gtgagcaaactggaactaagccttcaggagctacaagtgtcttcagcagctgctggtgtg
cccggggcaaaccctgtccttaataacttgttgtcatgtgtacaggaaatcagtgatgtg
gtgcagaggtag

DBGET integrated database retrieval system