KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660581
Entry
104660581         CDS       T03989                                 

Gene name
NCK2
Definition
(RefSeq) cytoplasmic protein NCK2 isoform X1
  KO
K19862  NCK adaptor protein 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04360  Axon guidance
rro04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104660581 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104660581 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    104660581 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104660581 (NCK2)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   104660581 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 104660581
NCBI-ProteinID: XP_010359286
UniProt: A0A2K6NSJ1
LinkDB
Position
17
AA seq 382 aa
MKMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVER
KNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPTNGSSADRIYDLNIPAFV
KFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPS
FLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCK
NARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECA
LNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEH
YKKAPIFTSEHGEKLYLVRALQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaaatgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggac
caggagctggacatcaagaagaacgagcggctgtggttgctggacgactccaagacgtgg
tggcgggtgaggaacgcggccaacaggacgggctatgtgccgtccaactacgtggagcgg
aagaacagcctgaagaagggctccctcgtgaagaacctgaaggacacgctaggccttggc
aagacgcgcaggaagaccagcgcgcgggacgcgtcccccacgcccagcacggatgctgag
taccccaccaatggcagcagcgccgaccgcatctacgacctcaacatcccggccttcgtc
aagttcgcctatgttgccgagcgggaggatgagctgtccttggtgaaggggtcacgtgtc
accgtcatggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggc
tggttcccctccaactacgtcctggaggaggtggacgaggcagctgcggagtccccgagc
ttcctgagcctgcgcaagggcgcctccctgagcaatggccagggctcccgcgtgctgcac
gtggtccagacgctgtaccccttcagctcagtcacggaggaggagctcaacttcgagaag
ggggagaccatggaggtgatcgagaagcccgagaacgaccccgagtggtggaaatgcaaa
aatgcccggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacggg
cctgccctgcaccctgcacacgccccacagataagctacaccgggccctcgtccagcggg
cgcttcgcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgcc
ctcaacgagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagc
gacttctccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcaactcgtg
gacaatgtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacac
tacaaaaaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggct
ctgcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663559
Entry
104663559         CDS       T03989                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1 isoform X1
  KO
K07365  NCK adaptor protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04360  Axon guidance
rro04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104663559 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104663559 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    104663559 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104663559 (NCK1)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   104663559 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 104663559
NCBI-ProteinID: XP_010363118
UniProt: A0A2K6RPL8
LinkDB
Position
1
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGRFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ttggatatcaagaaaaatgagagattatggcttctggatgattctaagtcctggtggcga
gttcgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctattgtaaaaaacctaaaggataccttaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagttttgttgaccca
ggggaacgtctctatgacctcaacatgcccgcttatgtgaaatttaactacatggctgag
agagaggatgaattgtcattgataaaggggacaaaggtgatcgtcatggaaaaatgcagt
gatgggtggtggcgtggtagctacaatggacaagttggatggttcccttcaaactatgta
actgaagaaggtgacagtcctttgggtgaccatgtgggttctctgtcagagaaattagca
gcagtcgtcaataacctaaataccgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcatctaacgatgaagaacttaatttcgagaaaggagatgtaatggatgttatt
gaaaaacctgaaaatgacccagaatggtggaaatgcaggaagatcaatggtatggttggt
ctagtaccaaagaactatgttaccgttatgcagaataatccattaacctcaggtttggaa
ccatcacctccacagtgtgattacattaggccttcactcacgggaaggtttgctggcaat
ccttggtattatggcaaagtcaccaggcatcaagcagaaatggcattaaacgaaagagga
cacgaaggggatttcctcattcgagatagtgaatcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagagactgtctactgc
attgggcagcgtaaattcagcaccatggaagaacttgtggaacattacaaaaaggcacca
atttttacaagtgaacaaggagaaaaattatatcttgtcaagcatttatcatga

DBGET integrated database retrieval system