KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660767
Entry
104660767         CDS       T03989                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04015  Rap1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05205  Proteoglycans in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104660767 (MAPK12)
   04015 Rap1 signaling pathway
    104660767 (MAPK12)
   04370 VEGF signaling pathway
    104660767 (MAPK12)
   04668 TNF signaling pathway
    104660767 (MAPK12)
   04068 FoxO signaling pathway
    104660767 (MAPK12)
   04071 Sphingolipid signaling pathway
    104660767 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104660767 (MAPK12)
   04218 Cellular senescence
    104660767 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104660767 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104660767 (MAPK12)
   04620 Toll-like receptor signaling pathway
    104660767 (MAPK12)
   04621 NOD-like receptor signaling pathway
    104660767 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    104660767 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    104660767 (MAPK12)
   04660 T cell receptor signaling pathway
    104660767 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    104660767 (MAPK12)
   04659 Th17 cell differentiation
    104660767 (MAPK12)
   04657 IL-17 signaling pathway
    104660767 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    104660767 (MAPK12)
   04670 Leukocyte transendothelial migration
    104660767 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104660767 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    104660767 (MAPK12)
   04917 Prolactin signaling pathway
    104660767 (MAPK12)
   04926 Relaxin signaling pathway
    104660767 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    104660767 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104660767 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    104660767 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    104660767 (MAPK12)
   04722 Neurotrophin signaling pathway
    104660767 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104660767 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104660767 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    104660767 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104660767 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104660767 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104660767 (MAPK12)
   05020 Prion disease
    104660767 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    104660767 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104660767 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104660767 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104660767 (MAPK12)
   05135 Yersinia infection
    104660767 (MAPK12)
   05133 Pertussis
    104660767 (MAPK12)
   05152 Tuberculosis
    104660767 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104660767 (MAPK12)
   05161 Hepatitis B
    104660767 (MAPK12)
   05171 Coronavirus disease - COVID-19
    104660767 (MAPK12)
   05163 Human cytomegalovirus infection
    104660767 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104660767 (MAPK12)
   05169 Epstein-Barr virus infection
    104660767 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104660767 (MAPK12)
   05140 Leishmaniasis
    104660767 (MAPK12)
   05142 Chagas disease
    104660767 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104660767 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104660767 (MAPK12)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104660767 (MAPK12)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104660767 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 104660767
NCBI-ProteinID: XP_010359544
LinkDB
Position
13
AA seq 390 aa
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRVSPGGGASHQPSPSAIPCLHVLPDLKPG
NLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMA
EMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASIL
TNASPLAVNLLEKMLVLDAEQRVTAAEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTL
DEWKRVTYKEVLSFKPPRQLGARVSKETAL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcctgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagccggtgggctcgggcgcctatggcgcg
gtgtgctcggccgtggacagccgcaccggcgccaaggtggccatcaagaagctgtatcgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaaacac
atgcgtcacgagaacgtgattgggctgctggacgtattcactcctgatgagaccctggat
gacttcacagacttttacctggtgatgccattcatgggcaccgacctgggcaagctcatg
aaacatgagaagctgggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ttgaggtatatccatgctgccggcatcatccacagagtgagtcctggtggaggagccagc
catcagccctcccccagcgcaatcccctgcctccacgtcctacctgacctgaagcctggc
aacctggctgtgaacgaagactgtgagctgaagatcctggactttggcctggccaggcag
gcagacagtgagatgactgggtatgtggtgacccggtggtaccgggcacccgaggtcatc
ttgaattggatgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcg
gagatgatcacaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggag
atcatgaaggtgacagggacgcctccagctgagtttgtgcagcggctgcagagtgatgag
gccaagaactacatgaagggcctccccgagttggagaagaaggattttgcctccatcctg
accaatgcaagccctctggctgtgaacctcctggagaagatgctggtgctggatgcggag
cagcgggtgacagcagccgaggcactggcccatccctacttcgagtccctgcacgacaca
gaagatgagccccaggtccagaagtatgacgactcctttgatgacgtggaccgcacgctg
gatgaatggaagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctg
ggagccagggtctccaaggagacggctctgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660769
Entry
104660769         CDS       T03989                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04015  Rap1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05205  Proteoglycans in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104660769 (MAPK11)
   04015 Rap1 signaling pathway
    104660769 (MAPK11)
   04370 VEGF signaling pathway
    104660769 (MAPK11)
   04668 TNF signaling pathway
    104660769 (MAPK11)
   04068 FoxO signaling pathway
    104660769 (MAPK11)
   04071 Sphingolipid signaling pathway
    104660769 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104660769 (MAPK11)
   04218 Cellular senescence
    104660769 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104660769 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104660769 (MAPK11)
   04620 Toll-like receptor signaling pathway
    104660769 (MAPK11)
   04621 NOD-like receptor signaling pathway
    104660769 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    104660769 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    104660769 (MAPK11)
   04660 T cell receptor signaling pathway
    104660769 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    104660769 (MAPK11)
   04659 Th17 cell differentiation
    104660769 (MAPK11)
   04657 IL-17 signaling pathway
    104660769 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    104660769 (MAPK11)
   04670 Leukocyte transendothelial migration
    104660769 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104660769 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    104660769 (MAPK11)
   04917 Prolactin signaling pathway
    104660769 (MAPK11)
   04926 Relaxin signaling pathway
    104660769 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    104660769 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104660769 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    104660769 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    104660769 (MAPK11)
   04722 Neurotrophin signaling pathway
    104660769 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104660769 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104660769 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    104660769 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104660769 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104660769 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104660769 (MAPK11)
   05020 Prion disease
    104660769 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    104660769 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104660769 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104660769 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104660769 (MAPK11)
   05135 Yersinia infection
    104660769 (MAPK11)
   05133 Pertussis
    104660769 (MAPK11)
   05152 Tuberculosis
    104660769 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104660769 (MAPK11)
   05161 Hepatitis B
    104660769 (MAPK11)
   05171 Coronavirus disease - COVID-19
    104660769 (MAPK11)
   05163 Human cytomegalovirus infection
    104660769 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104660769 (MAPK11)
   05169 Epstein-Barr virus infection
    104660769 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104660769 (MAPK11)
   05140 Leishmaniasis
    104660769 (MAPK11)
   05142 Chagas disease
    104660769 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104660769 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104660769 (MAPK11)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104660769 (MAPK11)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104660769 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 104660769
NCBI-ProteinID: XP_030770287
LinkDB
Position
13
AA seq 364 aa
MSGPSAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctagcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctccgtctgttcg
gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtctatcgaggacttcagc
gaagtgtacttggtgaccaccctcatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctggtttaccaactgctgcgcgggctaaagtac
atccactcggcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggacttcgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctaaactggatgcattac
aaccagacagtggacatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccccgaggttctggcaaagatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccatggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgccgcc
gaggcactggcccacgcctacttcagccagtaccacgaccctgaggatgagccagaggcc
gagccgtatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682867
Entry
104682867         CDS       T03989                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04015  Rap1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05205  Proteoglycans in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104682867 (MAPK14)
   04015 Rap1 signaling pathway
    104682867 (MAPK14)
   04370 VEGF signaling pathway
    104682867 (MAPK14)
   04668 TNF signaling pathway
    104682867 (MAPK14)
   04068 FoxO signaling pathway
    104682867 (MAPK14)
   04071 Sphingolipid signaling pathway
    104682867 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104682867 (MAPK14)
   04218 Cellular senescence
    104682867 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682867 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104682867 (MAPK14)
   04620 Toll-like receptor signaling pathway
    104682867 (MAPK14)
   04621 NOD-like receptor signaling pathway
    104682867 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    104682867 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    104682867 (MAPK14)
   04660 T cell receptor signaling pathway
    104682867 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    104682867 (MAPK14)
   04659 Th17 cell differentiation
    104682867 (MAPK14)
   04657 IL-17 signaling pathway
    104682867 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    104682867 (MAPK14)
   04670 Leukocyte transendothelial migration
    104682867 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104682867 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    104682867 (MAPK14)
   04917 Prolactin signaling pathway
    104682867 (MAPK14)
   04926 Relaxin signaling pathway
    104682867 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    104682867 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104682867 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    104682867 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    104682867 (MAPK14)
   04722 Neurotrophin signaling pathway
    104682867 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104682867 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104682867 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    104682867 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104682867 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104682867 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104682867 (MAPK14)
   05020 Prion disease
    104682867 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    104682867 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682867 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104682867 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104682867 (MAPK14)
   05135 Yersinia infection
    104682867 (MAPK14)
   05133 Pertussis
    104682867 (MAPK14)
   05152 Tuberculosis
    104682867 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104682867 (MAPK14)
   05161 Hepatitis B
    104682867 (MAPK14)
   05171 Coronavirus disease - COVID-19
    104682867 (MAPK14)
   05163 Human cytomegalovirus infection
    104682867 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104682867 (MAPK14)
   05169 Epstein-Barr virus infection
    104682867 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104682867 (MAPK14)
   05140 Leishmaniasis
    104682867 (MAPK14)
   05142 Chagas disease
    104682867 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104682867 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682867 (MAPK14)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104682867 (MAPK14)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104682867 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 104682867
NCBI-ProteinID: XP_010387975
UniProt: A0A2K6QA65
LinkDB
Position
4
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacagggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgttattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacatcattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682868
Entry
104682868         CDS       T03989                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04015  Rap1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04728  Dopaminergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04917  Prolactin signaling pathway
rro04926  Relaxin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05205  Proteoglycans in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104682868 (MAPK13)
   04015 Rap1 signaling pathway
    104682868 (MAPK13)
   04370 VEGF signaling pathway
    104682868 (MAPK13)
   04668 TNF signaling pathway
    104682868 (MAPK13)
   04068 FoxO signaling pathway
    104682868 (MAPK13)
   04071 Sphingolipid signaling pathway
    104682868 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104682868 (MAPK13)
   04218 Cellular senescence
    104682868 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682868 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104682868 (MAPK13)
   04620 Toll-like receptor signaling pathway
    104682868 (MAPK13)
   04621 NOD-like receptor signaling pathway
    104682868 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    104682868 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    104682868 (MAPK13)
   04660 T cell receptor signaling pathway
    104682868 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    104682868 (MAPK13)
   04659 Th17 cell differentiation
    104682868 (MAPK13)
   04657 IL-17 signaling pathway
    104682868 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    104682868 (MAPK13)
   04670 Leukocyte transendothelial migration
    104682868 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104682868 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    104682868 (MAPK13)
   04917 Prolactin signaling pathway
    104682868 (MAPK13)
   04926 Relaxin signaling pathway
    104682868 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    104682868 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104682868 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    104682868 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    104682868 (MAPK13)
   04722 Neurotrophin signaling pathway
    104682868 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104682868 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104682868 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    104682868 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104682868 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104682868 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104682868 (MAPK13)
   05020 Prion disease
    104682868 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    104682868 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682868 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104682868 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104682868 (MAPK13)
   05135 Yersinia infection
    104682868 (MAPK13)
   05133 Pertussis
    104682868 (MAPK13)
   05152 Tuberculosis
    104682868 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104682868 (MAPK13)
   05161 Hepatitis B
    104682868 (MAPK13)
   05171 Coronavirus disease - COVID-19
    104682868 (MAPK13)
   05163 Human cytomegalovirus infection
    104682868 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104682868 (MAPK13)
   05169 Epstein-Barr virus infection
    104682868 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104682868 (MAPK13)
   05140 Leishmaniasis
    104682868 (MAPK13)
   05142 Chagas disease
    104682868 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104682868 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682868 (MAPK13)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104682868 (MAPK13)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104682868 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2
Other DBs
NCBI-GeneID: 104682868
NCBI-ProteinID: XP_010387980
UniProt: A0A2K6RC57
LinkDB
Position
4
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDQRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHANAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtctccgacgcacgtcggcagcggggcctatggcgccgtgtgc
tcggccatcgaccagcggtcaggggagaaggtggccatcaagaagctgagccggcccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacagatttgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactcagctggggtcgtgcacagggacctgaagccaggcaacctagctgtgaatgag
gactgtgaactgaagatcctggattttgggctggcgcggcacgcaaatgccgagatgact
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgccaggcacagagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaagaaggatttcactcagctcttcccacgggccagcccccag
gccgtggacctgctggagaagatgctggagctagatgtggacaagcgcctgacagccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
caacagccatttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system