KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660878
Entry
104660878         CDS       T03989                                 

Gene name
PDE3A
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase A isoform X1
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104660878 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104660878 (PDE3A)
   04022 cGMP-PKG signaling pathway
    104660878 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104660878 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104660878 (PDE3A)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     104660878 (PDE3A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 104660878
NCBI-ProteinID: XP_010359655
UniProt: A0A2K6NWD2
LinkDB
Position
10
AA seq 1141 aa
MAVPVDAARVRDKPVHSGVSQAPTAGRDCHHRAELASPRDSGCRGCLGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAEEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEEIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGSRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYICSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTVKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLDRSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIS
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAAAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGVENQSLDPTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTPKPD
Q
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggcagtgcccgtcgacgctgcacgagtcagggacaagcccgtccacagtggggtgagt
caagcccccacggcgggccgggactgccaccatcgtgcagagctcgcatcgccgcgggac
tcgggctgccgtggctgcttgggagacctagtgctgcagccgctccggagctctcggaaa
ctttcctccgcgctgtgcgcgggctccctgtcctttctgctggcgctgctggtgaggctg
gtccgcggggaggtcggctgtgacctggagcagtgtaaggaggcggcggcggaggaggag
gaggaagcagccccgggagcagaagggggcgtcttcccggggcctcggggaggtgctccc
gggggcggcgcgcggctcagcccctggctgcagccctcagcgctgctcttcagtctcctg
tgtgccttcttctggatgggcttgtacctcctgcgcgccggggtgcgcctgcctctggct
gtcgcgctgctggccgcctgctgtgggggggaagcgctcgtccagattgggctgggcgtc
ggggaggatcacttactctcgctcccagccgcgggggtggtgctcagctgcttggccgcc
gcgacatggctggtgctgaggctgaggctgggcgtcctcatgatcgccttgactagcgcg
gtcaggaccgtgtccctcatttccttagagaggttcaaggtcgcctggagaccttacctg
gcgtacttggccggcgtgctggggatcctcttggccaggtacgtggaacaaatcttgccg
cagtccgcggaggcggctccaagggagcatttggggtcccagctcattgctgggaccaag
gaagagatcccggtgtttaagaggaggaggcggtccagctctgtcgtgtccgccgagatg
tccggctgcagcagcaagtcccatcggaggacctccctgccctgtataccgagggaacag
ctcatgggacattcagaatgggaccacaaacgagggtcaagaggatctcagtcttcagga
accagtattactgtggacatcgctgtcatgggcgaggcccacggcctcattaccgacctc
ctggcagacccttctcttccaccaaacgtgtgcacatccttgagagccgtgagcaacttg
ctcagcacacagctcaccttccaggccattcacaagcccagagtgaatcccgtcacttcg
ctcagtgaaaactatatctgttctgactctgaagagagctctgaaaaagacaagcttgct
attccaaagcgcctgagaaggagtttgccccctggcttgttgagaagagtttcttccact
tggaccaccaccacctcggccacaggtctacctaccttggagcctgcaccagtacggaga
gaccgcagcaccagcatcaaactgcaggaagcaccttcatccagtcctgattcttggaat
aatccagtgatgatgaccctcaccaaaagcagatcctttacttcatcctatgctatttct
gcagctaaccatgtaaaggctaaaaagcaaagtcgaccaggtgccctcgctaaaatttca
cctctttcatcgccctgctcctcacctctccaagggactcctgccagcagcctggtcagc
aaaatttctgcagtgcagtttccagaatctgctgacacaactgtcaaacaaagtctaggt
tctcacagggccttaacttacactcagagtgcccctgacctatcccctcaaatcctgact
ccacctgttatatgtagcagctgtggcagaccatattcccaagggaatcctgctgatgag
cccctggacagaagtggggtagccactcggacaccaagtagaacagatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagtgacattgtacagaatgaa
gatgaaacagagtgcctgagagagcctctgaggaaagcatcggcttgcagcacctatgct
cctgagaccatgatgtttctggacaaaccaattcttgctcccgaacctcttgtcatggat
aacctggactcaattatggagcagctaaatacttggaattttccgattttcgatttagtg
gaaaatataggaagaaaatgtggccgtattcttagtcaggtatcttacagactttttgaa
gacatgggcctctttgaagcttttaaaattccaattagggaatttatgaattattttcat
gctttggagattggatacagggatattccttatcataacagaatccatgccactgatgtt
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattagt
gaccatggttcaaccagtgattcagattctgacagtggatttacacatggacatatggga
tatgtattctcaaaaacgtataatgtgacagatgataaatacggatgtctgtctgggaat
atccctgccttagagttgatggcgctgtatgtggctgcagccatgcatgattatgatcac
ccaggaaggactaatgctttcctggttgcaactagtgctcctcaggcggtgctatataac
gatcgttcagttttggagaatcatcacgcagctgctgcatggaatcttttcatgtctcgg
ccagagtataacttcttagttaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacctgaagaaacactttgacttcgtagccaaattt
aatggcaaggtaaatgatgatgttggaatagattggaccaatgaaaatgatcgtctactg
gtttgtcaaatgtgtataaagttggctgatatcaatggtccagctaaatgtaaagaactc
catcttcagtggaccgatggtattgtcaatgaattttatgaacagggcgatgaagaggcc
agccttgggttacccataagccccttcatggatcgttctgctcctcagctggccaacctt
caggaatccttcatctctcacattgtggggcctctgtgcaactcctatgattcagccgga
ctaatgccaggaaaatgggtggaagacagtgatgagtcaggagataccgatgacccagaa
gaagaggaggaagaagcagcagcaccaaatgaagaggaaacctgtgaaaataatgaatct
ccaaaaaagaagactttcaaaaggagaaaaatctactgccaaataactcagcacctctta
cagaaccacaagatgtggaagaaagtcattgaagaggagcaacggttggcaggtgtagaa
aatcaatccctggacccgacccctcaatcgcactcttcagaacagatccaggctatcaag
gaagaagaagaagagaaagggaaaccaagaggggaggagataccaaccccaaagccagac
cagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681940
Entry
104681940         CDS       T03989                                 

Gene name
PDE3B
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase B isoform X1
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04371  Apelin signaling pathway
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104681940 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104681940 (PDE3B)
   04024 cAMP signaling pathway
    104681940 (PDE3B)
   04022 cGMP-PKG signaling pathway
    104681940 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104681940 (PDE3B)
   04922 Glucagon signaling pathway
    104681940 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    104681940 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    104681940 (PDE3B)
   04924 Renin secretion
    104681940 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104681940 (PDE3B)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     104681940 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 104681940
NCBI-ProteinID: XP_010386678
LinkDB
Position
15
AA seq 1117 aa
MRRDERDAKAMRSLQQPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRGSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSGGSWWLLALPACCYLGDFLVWQWWFWPWGDGD
AGSPATHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCILVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALALDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLIDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTRFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSSPTPQLRRSSGTSGLLPVEQSSRWERNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSPNHGPVAAGSLTNRSPIEFPDT
AGFLNKPSIILQRSLGNAPNTPDFYQQLRNSDSNLCNNCGHQILKYVSTSESDSTDCCSG
KSGEEENIFSKESFKVMETQQEEETEKKDSRKLFQEGDNWLTEEAQNEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
CGRIAYISSKSCSIPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPVSPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWIEAEEDN
DTESGDDEDGEELDTDDEEMENNLNPKPPRRKSRRQIFCQLMHHLTENHKIWKEIIEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEEERQFE
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagcagccggatggggct
ggctcgccccccgagagtctgaggaacggctacgtgaagagttgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctccccccagcagccgcggcgcggctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcctcagc
cccctctttagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagcggcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggttctggccttggggggatggcgac
gcagggtccccggccacgcacacgcccccggaggcggcggcgggcaggttgctgctggtg
ctgagctgcgtggggctgctgctgacgctcgcgcaccctctgcggctccggcactgcatc
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgctctcaggccgctgctttccggccttgtggggggcgctggctgcctgctggcc
ctggcgttggatcacttctttcaaatcagggaagcgcctcttcatcctcggctgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgcta
ggagaaactgcagcaagttactatggcagttgcaaaattttcaggagaccttcgttgcct
tgtatttcgagagaacagatgattctttgggattgggacttaaagcaatggtataagcct
cattatcaaaattctggaggcggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtttcagatcttctgattgatccaagccttccaccacaagtcatttcctctcta
cggagtatcagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacacgatttcctggattttacccctgctctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagttcgccaactccacagctgaggagg
agctcaggaacttcaggattgctgcctgttgaacagtcttcaagatgggaacgtaataat
ggcaaaaggcctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctgagaagagctggtgttttgtccagtctgagtcctgtgaattctcccaac
catggaccagtggctgctggctctctaactaatcgatcacccatagaatttcctgatact
gctggttttcttaataagccaagcattattttacagagatctctgggcaatgcaccgaat
acaccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacaactgtgga
catcaaatactgaaatatgtttcaacatctgaatcagacagtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcaaaagaatcattcaaagttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataattgg
ctaacagaagaggcacagaatgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagagaagatgagcaactggaattttcca
atttttgaacttgttgaaaagatgggagagaaatcaggaaggattcttagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtcctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
tgtgggcgaattgcttatatttcttcgaagagctgctctattccagatgagagttatggc
tgcctgtcttcaaacatccctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacgaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcatcgaagcaatccttgccacagatcttaaaaagcattttgat
tttcttgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatctgggtctgcccgtcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggatagaagcagaagaggataat
gatactgaaagtggtgatgatgaagatggtgaagaattagatacagatgatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcaaatattttgtcag
ctaatgcaccatctcactgaaaaccacaagatatggaaggaaatcatagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtcattgaagaagcagatgaagaggaagagcgacagtttgagtaa

DBGET integrated database retrieval system