KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660959
Entry
104660959         CDS       T03989                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3 isoform X2
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04062  Chemokine signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05223  Non-small cell lung cancer
rro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104660959 (JAK3)
   04151 PI3K-Akt signaling pathway
    104660959 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104660959 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104660959 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104660959 (JAK3)
   04659 Th17 cell differentiation
    104660959 (JAK3)
   04062 Chemokine signaling pathway
    104660959 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660959 (JAK3)
   05203 Viral carcinogenesis
    104660959 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    104660959 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    104660959 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104660959 (JAK3)
   05161 Hepatitis B
    104660959 (JAK3)
   05162 Measles
    104660959 (JAK3)
   05169 Epstein-Barr virus infection
    104660959 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104660959 (JAK3)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104660959 (JAK3)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104660959 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo SH2 APH Kinase-like LRR_RI_capping
Other DBs
NCBI-GeneID: 104660959
NCBI-ProteinID: XP_010359735
LinkDB
Position
8
AA seq 1167 aa
MTVAQETKGPTQEGAEWDFPLAASRLCSPFEGPGSLPARQVALMAPPSEETPLIPQRSCS
LLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSLFALATED
LSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLDKCHRFGLRKDLASAILDLPVLEHL
FAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPS
LRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVG
LPGVPGGQDGMGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRL
VTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFCKEVAPPRLLEEVAEQCH
GPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQSPLGPDYKGCLIQRSPTGT
FFLVGLSRSHSSLRELLAACWDGRLHVDGVAVTLTSCCIPRPKEKSNLIVVQRGCSPPTS
SLVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEAVDGESRKTEVLLKV
MDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGH
LVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPA
VLSLEMLTDRIPWVAPECLREAQTLNLEADKWGFGATVWEVFSGVTMPISALDPAKKLQF
YEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISSDYELLSDPTPGALA
PRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQL
QHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRH
RARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLD
KDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRM
MGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSTLGPQLDV
LWSGSRGCETHAFTAHPEGKPHSLSFL
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgacagtggctcaggaaaccaaggggcccacacaggaaggagccgagtgggactttcct
ctcgctgcctcccggctctgctctcccttcgaaggcccagggtccctgcctgctaggcaa
gttgcactcatggcacctccaagtgaggagacacccctgatccctcagcgctcctgcagc
ctcttgtccacggaggctggtgccctgcacgtgctactgcccgctcggggccccgggccc
ccccagcgcctatctttctcctttggggaccacttggctgaagacctgtgcgtgcaggct
gccaaggccagcggcatcctgcctgtgtaccactccctctttgctctggccacggaggac
ctgtcctgctggttccccccgagccacatcttctccgtggaggatgccagcacccaagtc
ctgctctacaggattcgcttttacttccccaattggtttgggctggacaagtgccaccgc
ttcgggctacgcaaggatttggccagcgctatccttgacctgccagtcctggagcacctc
tttgcccagcaccgcagtgacctggtgagtgggcgcctccctgtgggcctcagcctcaag
gagcagggtgagtgtctcagcctggccgtgctggacctggcccggatggcgcgagagcag
gcccagcggccaggagagctgctgaagactgtcagctacaaggcctgcctacccccaagc
ctgcgcgacctgatccagggcctgagtttcgtgacgcggaggcgtattcggaggacagtg
cgcagggccctgcgccgcgtggccgcctgccaggccgaccggcactcgctcatggccaag
tacattatggatctggagcggctggatccggctggggccgccgagaccttccatgtgggc
ctccctggggtccctggtggccaggacgggatggggctgctccgcgtggctggtgacgga
ggcatcgcctggacccagggagaacaggaggtcctccagcccttctgcgactttccagaa
atcgtagacattagcatcaagcaggccccgcgcgttggcccggccggggagcaccgcctg
gtcactgtcaccaggacagacaaccagattttggaggccgagttcccggggctgcccgag
gctctgtctttcgtggcgctcgtggacggctacttccggctgaccacggactcccagcac
ttcttctgcaaggaggtggcaccgccgaggctgctggaggaggtggcagagcagtgccac
ggccccatcactctggactttgccataaacaagcttaagactgggggctcacgtcctggc
tcctatgttctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgta
cagagcccccttggtcctgattataagggttgcctcattcagcgcagccccacagggacc
ttctttctggttggcctcagccgatcccacagcagccttcgagagctcctggcagcctgc
tgggatgggaggctgcatgtagatggggttgcagtgaccctcacctcctgctgtatcccc
agacccaaagaaaagtccaacttgatcgtggtccagagaggttgcagcccacccacgtcc
tccctggttcagccccaatcccaatgtcagctgagtcagatgacatttcacaagatcccc
gctgacagcctagagtggcatgagaacctgggccatgggtccttcaccaagatttaccgg
ggctgtcgccacgaggcggtggatggggagtcccgaaagacagaggtgctgctaaaagtg
atggatgctaagcacaagaactgcatggagtcattcctggaagcagcgagcttgatgagc
caagtgtcgtaccggcatctcgtgctgctccacggcgtgtgcatggctggagacagcacc
atggtgcaagaatttgtacacctgggggcgatagacatgtatctgcgaaaacgtggccac
ctggtgccagccagctggaagctgcaggtggtcaaacagctggcctacgccctcaactat
ctggaggacaaaggcctcccccacggcaatgtctccgcccggaaggtgctcctggctcgg
gagggggctgatgggagcccacccttcatcaagctgagtgaccctggggtcagccccgct
gtgttaagcctggagatgctcaccgacaggatcccctgggtggctcccgagtgtcttcgg
gaggcccagacacttaacttggaagctgacaagtggggcttcggtgccacggtctgggag
gtgtttagtggcgtcaccatgcccatcagcgccctggatcctgctaagaaactccaattt
tatgaggaccggcagcagctgccggcccccaagtggacagagctggccctgctgattcaa
cagtgcatggcctatgagccggtccagaggccctccttccgagccgtcattcgtgacctc
aacagcctcatctcttcagactatgagctcctctcagaccccacacctggtgccctggca
cctcgtgatgggctgtggaatggtgcccagctctatgcctgccaagaccccacgatcttc
gaggagagacacctcaagtacatctcacagctgggcaagggcaactttggcagtgtggag
ctgtgccgctatgacccgctaggcgacaacacaggtgccctggtggccgtgaaacagctg
cagcacagcgggccagaccagcagagggacttccagcgggagattcagatcctcaaagca
ctgcacagtgatttcattgtcaagtatcgtggtgtcagctatggcccgggccgccagagc
ctgcggctggtcatggagtacctgcccagcggctgcttgcgcgacttcctgcagcggcac
cgcgcgcgcctcgatgccagccgcctccttctctactcctcgcagatctgcaagggcatg
gagtacctgggctcccgccgctgcgtgcaccgcgacctggccgcccgaaacatcctggtg
gagagcgaggcccacgtcaagatcgctgacttcggcctagctaagctgctgccgcttgac
aaagactactacgtggtccgcgagccgggccagagccccattttctggtatgcccccgaa
tccctctcggacaacatcttctctcgccagtcagacgtctggagcttcggggtcgtcctg
tacgagctcttcacctactgtgacaaaagctgcagcccctcggccgagtttctgcggatg
atgggatgtgagcgggatgtccccgccctctgccgcctcttggaactgctggaggagggc
cagaggctgccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgc
tgggcccctagcccacaggaccggccatcattcagcaccctgggcccccagctggacgtg
ctgtggagcggaagccgggggtgtgagactcacgccttcactgctcacccagagggcaaa
ccacactccctgtcctttttatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665700
Entry
104665700         CDS       T03989                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2 isoform X1
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04062  Chemokine signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04725  Cholinergic synapse
rro04917  Prolactin signaling pathway
rro04920  Adipocytokine signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05140  Leishmaniasis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05200  Pathways in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665700 (JAK2)
   04151 PI3K-Akt signaling pathway
    104665700 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104665700 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104665700 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104665700 (JAK2)
   04659 Th17 cell differentiation
    104665700 (JAK2)
   04062 Chemokine signaling pathway
    104665700 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104665700 (JAK2)
   04917 Prolactin signaling pathway
    104665700 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    104665700 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    104665700 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665700 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104665700 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104665700 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104665700 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104665700 (JAK2)
   05164 Influenza A
    104665700 (JAK2)
   05168 Herpes simplex virus 1 infection
    104665700 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104665700 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104665700 (JAK2)
   05140 Leishmaniasis
    104665700 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104665700 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104665700 (JAK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104665700 (JAK2)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104665700 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like
Other DBs
NCBI-GeneID: 104665700
NCBI-ProteinID: XP_030775231
LinkDB
Position
16
AA seq 1130 aa
MACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEY
VAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPR
WYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMA
VLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQ
CKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSRGK
HKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSDESRVVTIHKQDGKNLEIELSSLREA
LSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQTGL
YVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFNSLKDLLNCYQ
METVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRN
EDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMS
KLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMH
FLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPE
CIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELAN
LINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPDGCPDEIYMIMTECWNNNVNLRPSFRDLALRVDQIRDNMAG
NT seq 3393 nt   +upstreamnt  +downstreamnt
atggcctgccttactatgacagaaatggagggaacatccacatcttctatatatcagaat
ggtgatatttctggaaatgccaattctatgaagcaaatagatccagtccttcaggtgtat
ctttaccattcccttgggaaatctgaggcagattatctgacctttccatctggggagtat
gttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtgtatcat
aatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccatgtcttc
catatagatgagtcaaccaggcataatgtactctacagaataagattttattttcctcgt
tggtattgcagcggcagcaacagagcctatcggcatggaatatctcgaggtgctgaagct
cctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgattttgtg
catggatggataaaagtacccgtgactcatgaaacacaggaagaatgtcttgggatggca
gtgttagatatgatgagaatagccaaagaaaatgatcaaaccccactggccatctataac
tctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagactatcat
attttgacaaggaagcgaataaggtacagatttcgcagatttattcagcagttcagccaa
tgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaaccctgcag
tctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttcaggtgag
gagatttttgcaaccattataataactggaaacggtggaattcagtggtcaagagggaaa
cataaagaaagtgagacactgacagaacaggatttacagttatattgcgattttcctaat
attattgatgtcagtattaagcaagcaaaccaagagggttcagatgaaagccgagttgta
actatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagggaagct
ttgtctttcgtgtcattaattgatgggtattatagattaactgcagatgcacatcattac
ctctgtaaagaagtagcacctccaacagtgcttgaaaatatacaaagcaactgtcatggc
ccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagactggactg
tatgtacttcgatgcagtcctaaggactttaataaatattttctgacttttgctgtcgag
cgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaagagtac
aacctcagtgggacaaagaagaacttcaacagtcttaaagatcttttgaattgttaccag
atggaaaccgttcgctcagacaatataattttccagtttactaagtgctgtcccccaaag
ccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgtaccaacc
tcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatcagaaat
gaagatttgatatttaatgaaagccttggccaaggcacttttacaaagatttttaaaggc
atacgaagagaagtaggagactatggtcaactgcatgaaacagaagttcttttaaaagtt
ctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatgatgagc
aagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagaggagaat
attctggttcaggagtttgtaaaatttggatcactagatacatacctgaaaaagaataaa
aattgtataaatatattgtggaaacttgaagttgcaaaacagttggcatgggccatgcat
tttctagaagaaaacacccttattcatgggaatgtgtgcgccaaaaatattctacttatc
agagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcctggcatt
agtattacagttttgccaaaggacattcttcaggagagaataccatgggtaccacctgaa
tgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggtaccact
ttgtgggaaatctgcagtggaggagataaacctctaagtgctctggattctcaaagaaag
ctgcaattttatgaagataggcaccagcttcctgcaccaaagtgggcagaattagcaaac
cttataaataattgtatggattatgagccagatttcaggccttctttcagagccatcata
cgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgacatgtta
ccaaatatgaggataggtgccctagggttttctggtgcctttgaagacagggatcctaca
cagtttgaagagagacatttgaaatttctacagcaactcggcaagggtaattttgggagt
gtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtggctgtaaaa
aagcttcagcatagtactgaagagcacctgagagactttgaaagggaaattgaaatcctg
aaatccctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgctggtcgg
cgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactatcttcaa
aaacataaagaacggatagatcacaaaaaacttctgcagtacacatctcagatatgcaag
ggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaagaaatata
ttggtggagaatgagaacagagttaaaattggagattttgggttaaccaaagtcttgcca
caagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctggtatgcc
ccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagctttggagtg
gttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaatttatg
cgtatgattggcaatgataaacaaggacagatgatcgtgttccatttgatagaacttttg
aagaataatggaagattaccaagaccagatggatgcccagatgagatttatatgatcatg
acagaatgctggaacaataatgtaaatctgcgcccctcctttagagatttagctcttcga
gtggatcaaataagggataacatggctggatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668074
Entry
104668074         CDS       T03989                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1 isoform X1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05140  Leishmaniasis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104668074 (JAK1)
   04151 PI3K-Akt signaling pathway
    104668074 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104668074 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104668074 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104668074 (JAK1)
   04658 Th1 and Th2 cell differentiation
    104668074 (JAK1)
   04659 Th17 cell differentiation
    104668074 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104668074 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668074 (JAK1)
   05203 Viral carcinogenesis
    104668074 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104668074 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104668074 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104668074 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668074 (JAK1)
   05161 Hepatitis B
    104668074 (JAK1)
   05160 Hepatitis C
    104668074 (JAK1)
   05171 Coronavirus disease - COVID-19
    104668074 (JAK1)
   05164 Influenza A
    104668074 (JAK1)
   05162 Measles
    104668074 (JAK1)
   05168 Herpes simplex virus 1 infection
    104668074 (JAK1)
   05163 Human cytomegalovirus infection
    104668074 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104668074 (JAK1)
   05169 Epstein-Barr virus infection
    104668074 (JAK1)
   05165 Human papillomavirus infection
    104668074 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104668074 (JAK1)
   05140 Leishmaniasis
    104668074 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104668074 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104668074 (JAK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104668074 (JAK1)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104668074 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 104668074
NCBI-ProteinID: XP_010369011
UniProt: A0A2K6RHP9
LinkDB
Position
12
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYMSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKSKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatatgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctcccctctttgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccgactccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctatgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctctttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgaaaacgagtgtctggggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tatggcgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcaaatgacagtggaaacgttctgtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaagtaaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttatttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttctcatgag
gaggccttgtcctttgtgtcactggtagatggctacttccggctcaccgcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagcctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgttg
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcaacccgtctaccccatgagccagctgagttttgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctggg
accctgatggattacaaggatgatgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagtgatgtccttactacaccctggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaagataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagcgagtgtggtccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccgtggattgct
cccgagtgtgttgaggactccaagaacctgagcgtggctgctgacaagtggagctttgga
actacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcccttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaag
ccagcaactgaagtggaccccacgcattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcacgagaacattgtgaagtac
aaaggaatctgcacggaagatggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgtt
caccgtgacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaactgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatc
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggccttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670479
Entry
104670479         CDS       T03989                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro05145  Toxoplasmosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670479 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104670479 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104670479 (TYK2)
   04658 Th1 and Th2 cell differentiation
    104670479 (TYK2)
   04659 Th17 cell differentiation
    104670479 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104670479 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    104670479 (TYK2)
   05160 Hepatitis C
    104670479 (TYK2)
   05171 Coronavirus disease - COVID-19
    104670479 (TYK2)
   05164 Influenza A
    104670479 (TYK2)
   05162 Measles
    104670479 (TYK2)
   05168 Herpes simplex virus 1 infection
    104670479 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670479 (TYK2)
   05169 Epstein-Barr virus infection
    104670479 (TYK2)
   05165 Human papillomavirus infection
    104670479 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104670479 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104670479 (TYK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104670479 (TYK2)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104670479 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo RIO1 APH
Other DBs
NCBI-GeneID: 104670479
NCBI-ProteinID: XP_030790944
LinkDB
Position
8
AA seq 1190 aa
MPLRHRGTTRGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNYILEIPRDASLMLYFRMRFYFRNWHGMNPQEP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALRRGVPLEEVAKKTSFKDCIPLSFRRQIRQHSALTRLRLRNVFRR
FLQDFQPDRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGEAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVQEEVNKEEGSSGGSGRNPQASLSGKKAKAHK
AIGQPVDRLREPLWAYFCDFRDITHVVLKERCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGTQSLRLRKFPIEQQAGAFVLEGWGRSFPSIRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASTRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHVHLAFVHGICVRGPENIMVTEYMEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWMA
PECLPGGPNSLSIAMDKWGFGATLLEICFDGEAPLQSLSSSEKEHFYQRQHRLPEPSCPE
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHTLPDLADVLIVNPDSSASDPTVFHKRYL
KKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIEILRTLYHE
HIVKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQ
HYIHRDLAARNVLLDNDKLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYK
FYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGITQGQMTVLRLTELLERGERLPRP
DKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRGQAPSVFSVC
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgcctttgcgccatcgggggacgaccaggggcagcaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcgga
gagccctgggtcactttcagcgagtcatcactgacagctgaggaagtctgcatccacatc
gcacataaagtcggtatcactcctccttgtttcaatctcttcgccctcttcgatgctcag
gcccaagtctggttgcccccaaactacatcctagagatccccagggatgcaagcctgatg
ctgtatttccgcatgaggttttatttccggaactggcatggcatgaatcctcaggagccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcacgagttt
gtgaatgacgtggcatcactgtgggagctgtcgagcgaggaggagatccaccactttaag
aatgagagcctaggcatggcctttctgcacctctgtcaccttgctctccgccgtggtgtc
cccctggaggaggtggccaagaagaccagcttcaaggactgtatcccgctctccttccgt
cggcagatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcaggacttccagccagacagactctcccagcagatggtcatggtcaaatacctg
gccacacttgaacggctggcaccccgctttggcacagagcgtgtgcctgtgtgccacctg
aggctgctggcccaggcagagggggagccctgctacatccgggacagtggggaggcccct
acagaccctggccccgagtctgctgctggacccccaacccatgaggtgctggtgacaggc
actggtggcatccagtggtggccagtacaggaggaggtgaacaaggaggagggttctagt
ggcggcagcggcaggaacccccaagccagcctgtctgggaagaaggccaaggctcacaag
gcaatcggccagccggtggacaggctgcgggagccactgtgggcctacttctgcgacttc
cgggacatcacccacgtggtgctgaaagagcgctgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcctgccttcccgggctgcggcgctgtccttcgtgtcactggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccaggatgggatccatggacccctgctggagccgtttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcattggagcaccagccacccc
taccgcttgatcctcacagtggcccagcgtagccaggcaccagacggcacacagagcttg
cggctccggaagttccccattgagcagcaggctggggcctttgtgctggagggctggggc
cggtccttccccagcattcgggaacttggggccgccttgcagggctgcttgctgagggcc
ggggacgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaac
ctcatcatcatgcggggggctcgggccagcaccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtacgagggccgcctgcgagtagagggcagtggggaccctgaggagggcaag
atggacgacgaggaccccctcgtccctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggacccgagtcaccatgacattgccctggccttctatgagacagccagc
ctcatgagccaggtctcccacgtgcacctggccttcgtgcacggcatctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacatggagcacggacccctggacgtgtggctacgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggtacatggtaatgtgtgtggccggaacatc
ctgctggctcggctggggctggcagagggcacgagccccttcatcaagctgagtgatccc
ggcgtgggcctgggtgccctgtccagggaggagcgggtggagcggatcccctggatggcc
cccgaatgcctcccaggtgggcccaacagcctaagtattgccatggacaagtgggggttt
ggtgccaccctcctggagatctgctttgatggagaggcccctctgcagagcctcagctcc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccagag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccttcattccgc
accatcctgcgtgacctcacccggctgcagccccacactcttccagatcttgctgacgtc
ttgattgtgaacccggactcatcggcgtcagaccctacggttttccacaagcgctatttg
aaaaagatccgagatctgggcgagggtcacttcggcaaggtcagtttgtactgctacgat
ccgaccaacgacggcactggcgagatggtggcggtgaaagcccttaaggcagactgcggc
ccccagcaccgctcgggctggaagcaggagattgagattctgcgtacgctctatcacgag
cacatcgtcaagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtc
atggagtacgtgcccctgggcagcctccgagactacctgccccggcacagcgtggggctg
gcccagctgctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcag
cactacatccaccgagacctagccgcgcgcaacgtgctgctggacaacgacaagctggtc
aagatcggggactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtg
cgcgaggatggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataag
ttctactatgcgtccgatgtctggtccttcggggtgaccctgtatgagctgctgacgcac
tgtgactccagccagagcccccccacgaaattccttgagctcataggcatcacccagggt
cagatgacagttctgagactcaccgagttgctggaacgaggggagaggctgccacgaccc
gataaatgtccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcc
ttccgcccaaccttcgagaacctcatacccatcctgaagacagtccatgagaagtaccga
ggccaggccccttccgtgttcagtgtgtgctga

DBGET integrated database retrieval system