KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661006
Entry
104661006         CDS       T03989                                 

Gene name
TPM4
Definition
(RefSeq) tropomyosin alpha-4 chain isoform X1
  KO
K10375  tropomyosin 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104661006 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    104661006 (TPM4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104661006 (TPM4)
   05414 Dilated cardiomyopathy
    104661006 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104661006 (TPM4)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104661006 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II DUF3450 CENP-F_leu_zip Crescentin CCDC144C FPP TMF_DNA_bd HrpB7 DUF724 PspA_IM30 DHR10 MscS_porin EzrA DUF1664 XhlA CALCOCO1 Fib_alpha DUF745 TPR_MLP1_2 ADIP Lebercilin DUF948 GAS
Other DBs
NCBI-GeneID: 104661006
NCBI-ProteinID: XP_010359805
UniProt: A0A2K6Q9U1
LinkDB
Position
8
AA seq 248 aa
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAE
EADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSE
KEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQ
TLNELNCI
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggcctcaactccctggaggcggtgaaacgcaagatccaggccctgcagcagcag
gcggacgaggcggaagaccgcgcgcagggcctgcagcgggagctggacggcgagcgcgag
cggcgcgagaaagctgaaggtgatgtggccgccctcaaccgacgcatccagctcgttgag
gaggagttggacagggctcaggaacgactggccacggccctgcagaagctggaggaggca
gaaaaggctgcagatgagagtgagagaggaatgaaggtgatagaaaaccgggccatgaag
gatgaggagaagatggaaattcaggagatgcagctcaaagaggccaagcacattgcggaa
gaggctgaccgcaaatacgaggaggtagctcgtaagctggtcatcctggagggtgagctg
gagagggcagaggagcgtgcggaggtgtctgaactaaaatgtggtgacctggaagaagaa
ctcaagaatgttactaacaacctgaaatctctggaggctgcgtctgaaaagtattctgaa
aaggaggacaaatatgaagaagaaattaaacttctgtctgacaaactgaaagaggctgag
acccgtgctgaatttgcagagagaacggttgcaaaactggaaaagacaattgatgacctg
gaagagaaacttgcccaggccaaagaagagaacgtgggcttacatcagacactggatcag
acactaaacgaacttaactgtatataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663504
Entry
104663504         CDS       T03989                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X5
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104663504 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    104663504 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663504 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104663504 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104663504 (TPM3)
   05414 Dilated cardiomyopathy
    104663504 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104663504 (TPM3)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104663504 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM DUF745 Crescentin CENP-F_leu_zip XhlA DUF3450 ATG16 HrpB7 DHR10 DUF1664 SlyX Golgin_A5 Laminin_I AAA_13 DUF16 MAD
Other DBs
NCBI-GeneID: 104663504
NCBI-ProteinID: XP_010363015
UniProt: A0A2K6P5Y2
LinkDB
Position
8
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaaactgaaagggacagaggatgagctggacaag
tattcagaagctttgaaggatgcccaggagaagctggaactggcagagaagaaggctgct
gatgctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaagaggagctg
gaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcagaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagaa
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagac
aaatatgaggaagagatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggaactggaccacgccctcaat
gacatgacctctatataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670859
Entry
104670859         CDS       T03989                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain isoform X1
  KO
K10373  tropomyosin 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05206  MicroRNAs in cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104670859 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    104670859 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104670859 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670859 (TPM1)
   05414 Dilated cardiomyopathy
    104670859 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104670859 (TPM1)
   04147 Exosome [BR:rro04147]
    104670859 (TPM1)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104670859 (TPM1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   104670859 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM Crescentin DUF745 CENP-F_leu_zip Laminin_I DUF3450 ATG16 AAA_13 DUF1664 COG2 DUF16 Golgin_A5 Lebercilin Fib_alpha XhlA
Other DBs
NCBI-GeneID: 104670859
NCBI-ProteinID: XP_010372506
UniProt: A0A2K6NWB5
LinkDB
Position
5
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagctgagcaggcggaggccgacaagaaggcggcggaagacaggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tctgaggctctcaaagatgcccaggagaagctggagctggcagaaaaaaaggccaccgac
gctgaagccgatgtagcttctctgaacagacgcatccagctcgttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaggatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagtgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagagttgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tatgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672471
Entry
104672471         CDS       T03989                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin beta chain isoform X1
  KO
K10374  tropomyosin 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104672471 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    104672471 (TPM2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104672471 (TPM2)
   05414 Dilated cardiomyopathy
    104672471 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104672471 (TPM2)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104672471 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ ERM Crescentin TMF_DNA_bd CENP-F_leu_zip YscO Cluap1 HrpB7 MscS_porin ATG16 SlyX FlaC_arch DUF16 Golgin_A5 Suppressor_APC DUF1664 ADIP Spc7
Other DBs
NCBI-GeneID: 104672471
NCBI-ProteinID: XP_010374579
UniProt: A0A2K6R4Y7
LinkDB
Position
16
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccatcgac
cgcgccgagcaggccgaagctgacaagaagcaagctgaggaccgttgcaagcagctggag
gaggagcagcaggccctccagaagaagctgaaggggacagaggatgaggtggaaaagtat
tctgaatccgtgaaggaggcccaggagaaactggagcaggccgagaagaaggccactgat
gctgaggcagatgtggcctctctgaaccgccgcattcagctggttgaggaggagctggac
cgggcccaggagcgcctggctacagccctgcagaagctggaggaggccgagaaggcggct
gatgagagcgagagaggaatgaaggtcatcgaaaaccgggccatgaaggacgaggagaag
atggagctgcaggagatgcagctgaaggaggccaagcacatcgctgaggattcagaccgc
aaatacgaagaggtggccaggaagctggtgatcctggaaggagagctggagcgctcagag
gagagagctgaggtggctgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaggcccaggcggacaagtattccaccaaagaagataaa
tatgaagaggagatcaaactgttggaggagaagctgaaggaggctgagacccgagcagag
tttgctgagaggtctgtggcaaagttggagaaaaccatcgatgacctagaagatgaagtc
tatgcccagaagatgaagtacaaggccattagcgaggaactggacaacgcactcaatgat
atcacctccctctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677298
Entry
104677298         CDS       T03989                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104677298
   04261 Adrenergic signaling in cardiomyocytes
    104677298
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677298
  09162 Cancer: specific types
   05216 Thyroid cancer
    104677298
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677298
   05414 Dilated cardiomyopathy
    104677298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104677298
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     104677298
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip CLZ EzrA DUF745 SNARE DUF1664 MAD BORCS7 Fib_alpha Lebercilin Crescentin CALCOCO1
Other DBs
NCBI-GeneID: 104677298
NCBI-ProteinID: XP_010380576
LinkDB
Position
10
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADKSERGMKVIENWALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETHAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgatgcagaggagcgagctgagcgcctccaacgagaagttgagggagaaaggagg
gctcgggaacaggctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcg
gaaaaagctgctgataagagtgagagaggtatgaaggttattgaaaactgggccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
attagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccatgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115898675
Entry
115898675         CDS       T03989                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like isoform X1
  KO
K09290  tropomyosin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    115898675
   04261 Adrenergic signaling in cardiomyocytes
    115898675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115898675
  09162 Cancer: specific types
   05216 Thyroid cancer
    115898675
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    115898675
   05414 Dilated cardiomyopathy
    115898675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    115898675
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     115898675
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip DHR10 WES_acyltransf BORCS7 Lebercilin MAD DUF1664 V_ATPase_I CLZ
Other DBs
NCBI-GeneID: 115898675
NCBI-ProteinID: XP_030789803
LinkDB
Position
7
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAWEQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGVLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgggatcaccaccatcgaggcggtgaagcgcaagatccaggttctgcagcagcag
gcagatgatgcagaggagcgagctgagcgcctccaacgagaagttgagggagaaaggcgg
gcttgggaacaggctgaggctgaggtggcctccttgaatcgtaggatccagctggttgaa
gaggagctggaccgtgctcaggagcggctggccactgccctgcaaaaactggaagaagcg
gaaaaagctgctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaa
gaggcagataggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagtcttg
gaacgcacagaggaacgagctgagctggcagagtcccgttgccgagagatggatgagcag
attagactgatggaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaa
aaagaagacaaatatgaggaagagatcaagattcttactgataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggaaaagacaattgatgacttg
gaagataaactgaaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

DBGET integrated database retrieval system