KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661051
Entry
104661051         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04340  Hedgehog signaling pathway
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104661051
   04014 Ras signaling pathway
    104661051
   04310 Wnt signaling pathway
    104661051
   04340 Hedgehog signaling pathway
    104661051
   04371 Apelin signaling pathway
    104661051
   04020 Calcium signaling pathway
    104661051
   04024 cAMP signaling pathway
    104661051
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104661051
  09143 Cell growth and death
   04114 Oocyte meiosis
    104661051
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104661051
   04540 Gap junction
    104661051
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104661051
   04062 Chemokine signaling pathway
    104661051
  09152 Endocrine system
   04911 Insulin secretion
    104661051
   04910 Insulin signaling pathway
    104661051
   04922 Glucagon signaling pathway
    104661051
   04923 Regulation of lipolysis in adipocytes
    104661051
   04912 GnRH signaling pathway
    104661051
   04913 Ovarian steroidogenesis
    104661051
   04915 Estrogen signaling pathway
    104661051
   04914 Progesterone-mediated oocyte maturation
    104661051
   04921 Oxytocin signaling pathway
    104661051
   04926 Relaxin signaling pathway
    104661051
   04935 Growth hormone synthesis, secretion and action
    104661051
   04918 Thyroid hormone synthesis
    104661051
   04919 Thyroid hormone signaling pathway
    104661051
   04928 Parathyroid hormone synthesis, secretion and action
    104661051
   04916 Melanogenesis
    104661051
   04924 Renin secretion
    104661051
   04925 Aldosterone synthesis and secretion
    104661051
   04927 Cortisol synthesis and secretion
    104661051
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104661051
   04270 Vascular smooth muscle contraction
    104661051
  09154 Digestive system
   04970 Salivary secretion
    104661051
   04971 Gastric acid secretion
    104661051
   04976 Bile secretion
    104661051
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104661051
   04961 Endocrine and other factor-regulated calcium reabsorption
    104661051
  09156 Nervous system
   04724 Glutamatergic synapse
    104661051
   04727 GABAergic synapse
    104661051
   04725 Cholinergic synapse
    104661051
   04728 Dopaminergic synapse
    104661051
   04726 Serotonergic synapse
    104661051
   04720 Long-term potentiation
    104661051
   04723 Retrograde endocannabinoid signaling
    104661051
  09157 Sensory system
   04740 Olfactory transduction
    104661051
   04742 Taste transduction
    104661051
   04750 Inflammatory mediator regulation of TRP channels
    104661051
  09149 Aging
   04211 Longevity regulating pathway
    104661051
   04213 Longevity regulating pathway - multiple species
    104661051
  09159 Environmental adaptation
   04713 Circadian entrainment
    104661051
   04714 Thermogenesis
    104661051
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661051
   05205 Proteoglycans in cancer
    104661051
   05203 Viral carcinogenesis
    104661051
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104661051
   05020 Prion disease
    104661051
  09165 Substance dependence
   05030 Cocaine addiction
    104661051
   05031 Amphetamine addiction
    104661051
   05032 Morphine addiction
    104661051
   05034 Alcoholism
    104661051
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104661051
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104661051
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661051
   05163 Human cytomegalovirus infection
    104661051
   05165 Human papillomavirus infection
    104661051
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104661051
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104661051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104661051
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104661051
   03036 Chromosome and associated proteins [BR:rro03036]
    104661051
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104661051
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKA family
   104661051
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104661051
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104661051
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 104661051
NCBI-ProteinID: XP_030783831
LinkDB
Position
3
AA seq 364 aa
MFALGCRGAEEWASGETSLEPALEQCPCDXHXEEQGQLGAKVTAEPPKGACYPSPRGLHL
RPGLPREGARGTAKSQGYKYLGWRRPWPWNVVKEFLAKAKEDFLKKWESPAQNTAHLDQF
ERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFL
VKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLI
YRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWA
LGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRSGCGDTVLEETDPSLLTRPTPWGALLV
VRII
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgttcgccttgggatgccgtggggccgaggagtgggcatcgggcgagacttcccttgaa
ccagctctggagcaatgcccttgcgattgacacngagaggaacagggccagctgggggcc
aaggtgacagctgagccccccaagggcgcctgctacccgagcccccgaggcctccatctc
aggcccggcctccccagagaaggggccagaggaacagccaaatcccaaggctataaatac
ctcggctggcgtcggccctggccatggaatgtcgtgaaagaattcttagccaaagccaaa
gaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccacttggatcagttt
gaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctggtgaaacacaag
gagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtggtgaagctgaaa
cagatcgaacataccctgaatgaaaagcgcatcctgcaagccgtcaactttccgttcctc
gtcaaactcgagttctccttcaaggacaactcaaacttatacatggtcatggaatacgtg
cccggtggggagatgttctcacacctacggcggattggaaggttcagcgagccccatgcc
cgtttctacgcggcccagatcgttctgaccttcgagtatctgcactcgctggatctcatc
tacagggacctgaagccggagaatctgctcattgaccagcagggatacattcaggtgaca
gacttcggtttcgccaagcgtgtgaagggccgcacttggaccttgtgcggcacccctgag
tatctggcccctgagattatcctgagcaaaggctacaacaaggccgtggactggtgggcc
ctgggggttcttatctatgaaatggccgctggctacccgcccttcttcgcagaccagccc
atccagatctatgagaagatcgtctctgggaaggtgaggtccggctgcggggacacagtc
ctggaagaaacagacccttccctgctcacccgtcctactccctggggagccctgcttgtt
gtcagaataatctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662061
Entry
104662061         CDS       T03989                                 

Gene name
PRKACG
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04340  Hedgehog signaling pathway
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104662061 (PRKACG)
   04014 Ras signaling pathway
    104662061 (PRKACG)
   04310 Wnt signaling pathway
    104662061 (PRKACG)
   04340 Hedgehog signaling pathway
    104662061 (PRKACG)
   04371 Apelin signaling pathway
    104662061 (PRKACG)
   04020 Calcium signaling pathway
    104662061 (PRKACG)
   04024 cAMP signaling pathway
    104662061 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104662061 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104662061 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104662061 (PRKACG)
   04540 Gap junction
    104662061 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104662061 (PRKACG)
   04062 Chemokine signaling pathway
    104662061 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    104662061 (PRKACG)
   04910 Insulin signaling pathway
    104662061 (PRKACG)
   04922 Glucagon signaling pathway
    104662061 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    104662061 (PRKACG)
   04912 GnRH signaling pathway
    104662061 (PRKACG)
   04913 Ovarian steroidogenesis
    104662061 (PRKACG)
   04915 Estrogen signaling pathway
    104662061 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    104662061 (PRKACG)
   04921 Oxytocin signaling pathway
    104662061 (PRKACG)
   04926 Relaxin signaling pathway
    104662061 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    104662061 (PRKACG)
   04918 Thyroid hormone synthesis
    104662061 (PRKACG)
   04919 Thyroid hormone signaling pathway
    104662061 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    104662061 (PRKACG)
   04916 Melanogenesis
    104662061 (PRKACG)
   04924 Renin secretion
    104662061 (PRKACG)
   04925 Aldosterone synthesis and secretion
    104662061 (PRKACG)
   04927 Cortisol synthesis and secretion
    104662061 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104662061 (PRKACG)
   04270 Vascular smooth muscle contraction
    104662061 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    104662061 (PRKACG)
   04971 Gastric acid secretion
    104662061 (PRKACG)
   04976 Bile secretion
    104662061 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104662061 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104662061 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    104662061 (PRKACG)
   04727 GABAergic synapse
    104662061 (PRKACG)
   04725 Cholinergic synapse
    104662061 (PRKACG)
   04728 Dopaminergic synapse
    104662061 (PRKACG)
   04726 Serotonergic synapse
    104662061 (PRKACG)
   04720 Long-term potentiation
    104662061 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    104662061 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    104662061 (PRKACG)
   04742 Taste transduction
    104662061 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    104662061 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    104662061 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    104662061 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104662061 (PRKACG)
   04714 Thermogenesis
    104662061 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662061 (PRKACG)
   05205 Proteoglycans in cancer
    104662061 (PRKACG)
   05203 Viral carcinogenesis
    104662061 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104662061 (PRKACG)
   05020 Prion disease
    104662061 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    104662061 (PRKACG)
   05031 Amphetamine addiction
    104662061 (PRKACG)
   05032 Morphine addiction
    104662061 (PRKACG)
   05034 Alcoholism
    104662061 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104662061 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104662061 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662061 (PRKACG)
   05163 Human cytomegalovirus infection
    104662061 (PRKACG)
   05165 Human papillomavirus infection
    104662061 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104662061 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104662061 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104662061 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104662061 (PRKACG)
   03036 Chromosome and associated proteins [BR:rro03036]
    104662061 (PRKACG)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104662061 (PRKACG)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKA family
   104662061 (PRKACG)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104662061 (PRKACG)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104662061 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo RIO1
Other DBs
NCBI-GeneID: 104662061
NCBI-ProteinID: XP_010361268
LinkDB
Position
16
AA seq 350 aa
MGNAAAKKDTEQESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLKTLGTGSYGRVMLV
RHRETGTHYAMKILDKQKVVRLKQVEHTLNEKRILQAINFPFVVKLQFSFKDNSNLYLVM
EYVPGGEMFSHLRRVGRFSEPHACFYAAQVVLAFQYLHSLDLVHRDLKPENLLIDQQGYL
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMTAGFPPFYA
DQPIQIYEKIISGKVRFPFQLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATT
NWIALFEKKVEAPFIPKYTGPGDASNFDDYEEEEIRISINEKCASEFAEF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccaagaaggacaccgagcaggagagcgtgaacgagttcctagcc
aaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagctcg
gatcagtttgaacggctcaagacgttgggcaccggctcctacgggcgggtgatgctggtg
aggcaccgggagaccggcacccactacgccatgaagatcctcgacaagcagaaggtggtg
aggctgaagcaggtcgagcacacactgaacgagaagcgcatcctgcaggcgatcaacttt
ccgttcgttgtcaagctccagttctcctttaaggacaactccaacctgtacctggtgatg
gagtatgtgccgggtggggagatgttctctcacctacggcgcgtcggaaggttcagcgag
ccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcgctc
gacctcgtccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctacctg
caggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccctgtgcggg
accccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggctgtggac
tggtgggccctaggggtgctcatctatgagatgaccgcgggcttcccgcccttctacgcc
gaccagcccatccagatctacgagaagatcatctctgggaaggtgcggtttcccttccaa
ctcagctctgacctcaaggacctgctgcggagcctgctgcaggtggacctcaccaagcgc
ttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggtttgccacaacc
aactggatcgccctctttgagaagaaggtggaagctcccttcatcccgaagtacacaggc
cctggggatgccagtaactttgacgactacgaggaagaagagatccggatctccatcaat
gagaagtgtgccagcgagtttgctgagttttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677489
Entry
104677489         CDS       T03989                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04310  Wnt signaling pathway
rro04340  Hedgehog signaling pathway
rro04371  Apelin signaling pathway
rro04530  Tight junction
rro04540  Gap junction
rro04611  Platelet activation
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04910  Insulin signaling pathway
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04961  Endocrine and other factor-regulated calcium reabsorption
rro04962  Vasopressin-regulated water reabsorption
rro04970  Salivary secretion
rro04971  Gastric acid secretion
rro04976  Bile secretion
rro05012  Parkinson disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05032  Morphine addiction
rro05034  Alcoholism
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104677489 (PRKACB)
   04014 Ras signaling pathway
    104677489 (PRKACB)
   04310 Wnt signaling pathway
    104677489 (PRKACB)
   04340 Hedgehog signaling pathway
    104677489 (PRKACB)
   04371 Apelin signaling pathway
    104677489 (PRKACB)
   04020 Calcium signaling pathway
    104677489 (PRKACB)
   04024 cAMP signaling pathway
    104677489 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104677489 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104677489 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104677489 (PRKACB)
   04540 Gap junction
    104677489 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104677489 (PRKACB)
   04062 Chemokine signaling pathway
    104677489 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    104677489 (PRKACB)
   04910 Insulin signaling pathway
    104677489 (PRKACB)
   04922 Glucagon signaling pathway
    104677489 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    104677489 (PRKACB)
   04912 GnRH signaling pathway
    104677489 (PRKACB)
   04913 Ovarian steroidogenesis
    104677489 (PRKACB)
   04915 Estrogen signaling pathway
    104677489 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    104677489 (PRKACB)
   04921 Oxytocin signaling pathway
    104677489 (PRKACB)
   04926 Relaxin signaling pathway
    104677489 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    104677489 (PRKACB)
   04918 Thyroid hormone synthesis
    104677489 (PRKACB)
   04919 Thyroid hormone signaling pathway
    104677489 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    104677489 (PRKACB)
   04916 Melanogenesis
    104677489 (PRKACB)
   04924 Renin secretion
    104677489 (PRKACB)
   04925 Aldosterone synthesis and secretion
    104677489 (PRKACB)
   04927 Cortisol synthesis and secretion
    104677489 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104677489 (PRKACB)
   04270 Vascular smooth muscle contraction
    104677489 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    104677489 (PRKACB)
   04971 Gastric acid secretion
    104677489 (PRKACB)
   04976 Bile secretion
    104677489 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104677489 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    104677489 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    104677489 (PRKACB)
   04727 GABAergic synapse
    104677489 (PRKACB)
   04725 Cholinergic synapse
    104677489 (PRKACB)
   04728 Dopaminergic synapse
    104677489 (PRKACB)
   04726 Serotonergic synapse
    104677489 (PRKACB)
   04720 Long-term potentiation
    104677489 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    104677489 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    104677489 (PRKACB)
   04742 Taste transduction
    104677489 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    104677489 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    104677489 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    104677489 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104677489 (PRKACB)
   04714 Thermogenesis
    104677489 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677489 (PRKACB)
   05205 Proteoglycans in cancer
    104677489 (PRKACB)
   05203 Viral carcinogenesis
    104677489 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104677489 (PRKACB)
   05020 Prion disease
    104677489 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    104677489 (PRKACB)
   05031 Amphetamine addiction
    104677489 (PRKACB)
   05032 Morphine addiction
    104677489 (PRKACB)
   05034 Alcoholism
    104677489 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104677489 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104677489 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677489 (PRKACB)
   05163 Human cytomegalovirus infection
    104677489 (PRKACB)
   05165 Human papillomavirus infection
    104677489 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104677489 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104677489 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104677489 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104677489 (PRKACB)
   03036 Chromosome and associated proteins [BR:rro03036]
    104677489 (PRKACB)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104677489 (PRKACB)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PKA family
   104677489 (PRKACB)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104677489 (PRKACB)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104677489 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 104677489
NCBI-ProteinID: XP_010380825
UniProt: A0A2K6NMR8
LinkDB
Position
12
AA seq 398 aa
MAAYREPPCNQYTGTTTALQKLEGFANRLFHRHSKGTAHDQKTALENDNLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctaaccggttatttcatagacactctaaaggtactgcacatgat
cagaaaacagctctggaaaatgacaaccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactcagaataatgccggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggat
aattctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatcta
agaagaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgcta
acattcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatcccacttcagttcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatatggaaatctaaagaatggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

DBGET integrated database retrieval system