KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661322
Entry
104661322         CDS       T03989                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04915  Estrogen signaling pathway
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104661322 (TGFA)
   04012 ErbB signaling pathway
    104661322 (TGFA)
   04014 Ras signaling pathway
    104661322 (TGFA)
   04151 PI3K-Akt signaling pathway
    104661322 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104661322 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661322 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104661322 (TGFA)
   05212 Pancreatic cancer
    104661322 (TGFA)
   05225 Hepatocellular carcinoma
    104661322 (TGFA)
   05214 Glioma
    104661322 (TGFA)
   05211 Renal cell carcinoma
    104661322 (TGFA)
   05215 Prostate cancer
    104661322 (TGFA)
   05223 Non-small cell lung cancer
    104661322 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104661322 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 104661322
NCBI-ProteinID: XP_010360203
UniProt: A0A2K6RBD7
LinkDB
Position
17
AA seq 166 aa
MFTIRRGALNLLSELLSFGGIVLATCQALENSTSLLSADPPVAAAVVSHFNDCPDSHTQF
CFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVL
IITCVLIHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgttcacgatccgcagaggcgccctcaatctcctttcagagctcttgagctttgggggt
attgtgttggccacgtgccaggccttggagaacagcacgtccctgctgagtgcagacccg
cccgtggccgcagcagtggtgtcccattttaatgactgcccagattcccacactcagttc
tgcttccatggaacctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccat
tctgggtacgttggtgcacgctgtgagcatgcggacctcctggctgtggtggccgccagt
cagaagaagcaggccatcaccgccttggtggtggtctccatcgtggccctggctgtcctt
atcatcacatgtgtgctgatacactgctgccaggtccgaaaacactgtgagtggtgccag
gccctcatctgccggcacgagaagcccagcgccctcctgaagggaagaaccgcttgctgc
cactcagaaacagtggtctga

DBGET integrated database retrieval system