KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661387
Entry
104661387         CDS       T03989                                 

Gene name
NKX2-8
Definition
(RefSeq) homeobox protein Nkx-2.8
  KO
K09347  homeobox protein Nkx-2.8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104661387 (NKX2-8)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104661387 (NKX2-8)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN XylR_N
Other DBs
NCBI-GeneID: 104661387
NCBI-ProteinID: XP_010360299
UniProt: A0A2K6PLA5
LinkDB
Position
5
AA seq 237 aa
MATSGRPSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLE
TSPPDSSQRPSVMPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASV
LRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQP
CGGGGEAGTAAAQDKCGAPTAAACPLPGYPAFCPGSALGLFPAYQHLAPPALVSWNW
NT seq 714 nt   +upstreamnt  +downstreamnt
atggccacctctggacgcccgagcttcaccgtgcgcagccttctagatttacccgagcag
gacgcgcaacacctgccgaggcgggagccagaaccacgcgccccccagcccgacccctgc
gccgcctggttggattcggagcgcggtcactacccctcctcggacgagagcagcctggag
accagcccgccagactcgtcgcagcggccgtccgttatgcctgcgtctccgggctcggac
gccgagaaaaggaagaagcggcgggtgctattctccaaggcgcagacgctggagttggag
cggcgcttccggcagcagcggtacctgtctgcgcccgagcgcgaacagctggctagtgtg
ctgcgcctcacgcccacgcaggtcaagatctggttccagaaccatcgctacaagctgaag
cgcgcgcgcgcgccgggggccgcggagtcgcccgacctggcagcgtccgccgagctgcac
gccgcgccaggcctgctccgtcgcgtggtggtgccggtgcttgttcgcgacgggcagccg
tgcggcggcggcggcgaggcgggcaccgccgcggcccaggacaagtgcggcgccccaaca
gccgccgcctgccctctgccgggctaccctgccttctgtcccggttcggcgcttggcctc
ttcccagcctaccagcacttagcgccccctgccctggtctcctggaactggtga

DBGET integrated database retrieval system