KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661739
Entry
104661739         CDS       T03989                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04218  Cellular senescence
rro04370  VEGF signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04722  Neurotrophin signaling pathway
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104661739 (MAPKAPK2)
   04370 VEGF signaling pathway
    104661739 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104661739 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104661739 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104661739 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104661739 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    104661739 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104661739 (MAPKAPK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104661739 (MAPKAPK2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   104661739 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 104661739
NCBI-ProteinID: XP_030791469
LinkDB
Position
8
AA seq 400 aa
MLSNSQGQSPPVPFPAPAPPPQPPAPAPPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctgtccaactcccagggccagagcccgccggtgcccttccccgccccggccccgccg
ccgcagcccccggcccctgccccgccgcaccccccggcgcagccgccgccgccgcccccg
cagcagttcccgcagttccatgtcaagtccggcctgcagatcaagaagaacgccatcatc
gatgactacaaggtcaccagccaggtcctggggctgggcatcaacgggaaagttttgcag
atcttcaacaagaggacccaggagaaattcgccctcaaaatgcttcaggactgccccaag
gcccgcagggaggtggagctgcactggcgggcctcccagtgcccgcacattgtacggatc
gtggatgtgtacgagaatctgtatgcagggaggaagtgcctgctgattgtcatggaatgt
ttggacggtggagaactctttagccgaatccaggaccgaggagaccaggcgttcacagaa
agagaggcatccgaaatcatgaagagcatcggtgaggccatccagtatctgcactcaatc
aacattgcccatcgggatgtcaagcctgagaatctcttatacacctcgaaaaggcccaac
gccatcctgaaactcactgactttggctttgccaaggaaaccaccagccacaactctttg
accactccttgttatacaccatactatgtggctccagaagtgctgggtccagagaagtat
gacaagtcctgtgacatgtggtccctgggtgtcatcatgtacatcctgctgtgtgggtat
ccccccttctactccaaccacggccttgccatctctccgggcatgaagactcgcatccga
atgggccagtatgaatttcccaacccagaatggtcagaagtatcagaggaagtgaagatg
ctcattcggaacctgctgaaaacagagcccacccagagaatgaccatcaccgagtttatg
aaccacccctggatcatgcaatcgacgaaggtccctcaaaccccactgcacaccagccgg
gtcctgaaggaggacaaggagcggtgggaggatgtcaaggaggagatgaccagtgccttg
gccacaatgcgcgttgactacgagcagatcaagataaaaaagattgaagatgcatccaac
cctctgctgctgaagaggcggaagaaagctcgggccctggaggctgcggccttggcccac
tga

DBGET integrated database retrieval system