KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661748
Entry
104661748         CDS       T03989                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04151  PI3K-Akt signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04672  Intestinal immune network for IgA production
rro04940  Type I diabetes mellitus
rro05135  Yersinia infection
rro05142  Chagas disease
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05320  Autoimmune thyroid disease
rro05321  Inflammatory bowel disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104661748 (IL2)
   04151 PI3K-Akt signaling pathway
    104661748 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661748 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104661748 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104661748 (IL2)
   04660 T cell receptor signaling pathway
    104661748 (IL2)
   04658 Th1 and Th2 cell differentiation
    104661748 (IL2)
   04659 Th17 cell differentiation
    104661748 (IL2)
   04672 Intestinal immune network for IgA production
    104661748 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661748 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104661748 (IL2)
   05321 Inflammatory bowel disease
    104661748 (IL2)
   05330 Allograft rejection
    104661748 (IL2)
   05332 Graft-versus-host disease
    104661748 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104661748 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104661748 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661748 (IL2)
   05162 Measles
    104661748 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104661748 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661748 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104661748 (IL2)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Interleukins
   104661748 (IL2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Haparin
  Cytokines
   104661748 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 104661748
NCBI-ProteinID: XP_010360811
UniProt: A0A2K6NXW2
LinkDB
Position
2
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagatactaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system