KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661761
Entry
104661761         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104661761
   04215 Apoptosis - multiple species
    104661761
   04115 p53 signaling pathway
    104661761
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661761
  09162 Cancer: specific types
   05210 Colorectal cancer
    104661761
   05222 Small cell lung cancer
    104661761
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104661761
   05012 Parkinson disease
    104661761
   05014 Amyotrophic lateral sclerosis
    104661761
   05016 Huntington disease
    104661761
   05017 Spinocerebellar ataxia
    104661761
   05020 Prion disease
    104661761
   05022 Pathways of neurodegeneration - multiple diseases
    104661761
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104661761
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104661761
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104661761
   05134 Legionellosis
    104661761
   05152 Tuberculosis
    104661761
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104661761
   05161 Hepatitis B
    104661761
   05160 Hepatitis C
    104661761
   05164 Influenza A
    104661761
   05162 Measles
    104661761
   05168 Herpes simplex virus 1 infection
    104661761
   05163 Human cytomegalovirus infection
    104661761
   05167 Kaposi sarcoma-associated herpesvirus infection
    104661761
   05169 Epstein-Barr virus infection
    104661761
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104661761
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104661761
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 104661761
NCBI-ProteinID: XP_010360822
UniProt: A0A2K6NSK5
LinkDB
Position
20
AA seq 102 aa
MGDVEKGKKIFVQKCAQCHAMEKGGKHKTGPNLFGRKTGQAVGFSHTDASKNKGITWGED
TLMEYLKNPKKYIPGTKMIFAGIKKEAERADLIAYLKKATNE
NT seq 309 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatgcc
atggaaaagggaggcaagcataagactgggcctaatctcttcgggcggaagacaggtcag
gccgttggattctctcacacagatgccagtaagaacaaaggcatcacctggggagaggat
acactgatggagtatttgaagaatcccaagaagtacatccctggaacaaaaatgatcttt
gccggcattaagaaggaggcagaaagggcagacttgatagcttatctcaaaaaagctact
aatgagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672188
Entry
104672188         CDS       T03989                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104672188
   04215 Apoptosis - multiple species
    104672188
   04115 p53 signaling pathway
    104672188
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672188
  09162 Cancer: specific types
   05210 Colorectal cancer
    104672188
   05222 Small cell lung cancer
    104672188
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104672188
   05012 Parkinson disease
    104672188
   05014 Amyotrophic lateral sclerosis
    104672188
   05016 Huntington disease
    104672188
   05017 Spinocerebellar ataxia
    104672188
   05020 Prion disease
    104672188
   05022 Pathways of neurodegeneration - multiple diseases
    104672188
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104672188
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104672188
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104672188
   05134 Legionellosis
    104672188
   05152 Tuberculosis
    104672188
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104672188
   05161 Hepatitis B
    104672188
   05160 Hepatitis C
    104672188
   05164 Influenza A
    104672188
   05162 Measles
    104672188
   05168 Herpes simplex virus 1 infection
    104672188
   05163 Human cytomegalovirus infection
    104672188
   05167 Kaposi sarcoma-associated herpesvirus infection
    104672188
   05169 Epstein-Barr virus infection
    104672188
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104672188
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104672188
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 104672188
NCBI-ProteinID: XP_010374228
UniProt: A0A2K6N726
LinkDB
Position
6
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679886
Entry
104679886         CDS       T03989                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104679886
   04215 Apoptosis - multiple species
    104679886
   04115 p53 signaling pathway
    104679886
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679886
  09162 Cancer: specific types
   05210 Colorectal cancer
    104679886
   05222 Small cell lung cancer
    104679886
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104679886
   05012 Parkinson disease
    104679886
   05014 Amyotrophic lateral sclerosis
    104679886
   05016 Huntington disease
    104679886
   05017 Spinocerebellar ataxia
    104679886
   05020 Prion disease
    104679886
   05022 Pathways of neurodegeneration - multiple diseases
    104679886
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104679886
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104679886
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104679886
   05134 Legionellosis
    104679886
   05152 Tuberculosis
    104679886
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104679886
   05161 Hepatitis B
    104679886
   05160 Hepatitis C
    104679886
   05164 Influenza A
    104679886
   05162 Measles
    104679886
   05168 Herpes simplex virus 1 infection
    104679886
   05163 Human cytomegalovirus infection
    104679886
   05167 Kaposi sarcoma-associated herpesvirus infection
    104679886
   05169 Epstein-Barr virus infection
    104679886
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104679886
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104679886
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 104679886
NCBI-ProteinID: XP_010383921
UniProt: A0A2K6N726
LinkDB
Position
9
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatcccgggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681924
Entry
104681924         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104681924
   04215 Apoptosis - multiple species
    104681924
   04115 p53 signaling pathway
    104681924
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681924
  09162 Cancer: specific types
   05210 Colorectal cancer
    104681924
   05222 Small cell lung cancer
    104681924
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104681924
   05012 Parkinson disease
    104681924
   05014 Amyotrophic lateral sclerosis
    104681924
   05016 Huntington disease
    104681924
   05017 Spinocerebellar ataxia
    104681924
   05020 Prion disease
    104681924
   05022 Pathways of neurodegeneration - multiple diseases
    104681924
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104681924
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104681924
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104681924
   05134 Legionellosis
    104681924
   05152 Tuberculosis
    104681924
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104681924
   05161 Hepatitis B
    104681924
   05160 Hepatitis C
    104681924
   05164 Influenza A
    104681924
   05162 Measles
    104681924
   05168 Herpes simplex virus 1 infection
    104681924
   05163 Human cytomegalovirus infection
    104681924
   05167 Kaposi sarcoma-associated herpesvirus infection
    104681924
   05169 Epstein-Barr virus infection
    104681924
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104681924
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104681924
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 104681924
NCBI-ProteinID: XP_010386658
UniProt: A0A2K6NB35
LinkDB
Position
4
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacact
gttgaaaagggaggcaagcacaagactgggcctaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgttggcattaagaaaaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaaagagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115893266
Entry
115893266         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115893266
   04215 Apoptosis - multiple species
    115893266
   04115 p53 signaling pathway
    115893266
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115893266
  09162 Cancer: specific types
   05210 Colorectal cancer
    115893266
   05222 Small cell lung cancer
    115893266
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115893266
   05012 Parkinson disease
    115893266
   05014 Amyotrophic lateral sclerosis
    115893266
   05016 Huntington disease
    115893266
   05017 Spinocerebellar ataxia
    115893266
   05020 Prion disease
    115893266
   05022 Pathways of neurodegeneration - multiple diseases
    115893266
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115893266
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115893266
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115893266
   05134 Legionellosis
    115893266
   05152 Tuberculosis
    115893266
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115893266
   05161 Hepatitis B
    115893266
   05160 Hepatitis C
    115893266
   05164 Influenza A
    115893266
   05162 Measles
    115893266
   05168 Herpes simplex virus 1 infection
    115893266
   05163 Human cytomegalovirus infection
    115893266
   05167 Kaposi sarcoma-associated herpesvirus infection
    115893266
   05169 Epstein-Barr virus infection
    115893266
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115893266
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115893266
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 115893266
NCBI-ProteinID: XP_030772697
LinkDB
Position
14
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTVANKNKGITW
GEDTLMEYLENPKKYIPGRKMVFAGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagtcgccaataagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaagaaaa
atggtctttgctggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115893541
Entry
115893541         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115893541
   04215 Apoptosis - multiple species
    115893541
   04115 p53 signaling pathway
    115893541
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115893541
  09162 Cancer: specific types
   05210 Colorectal cancer
    115893541
   05222 Small cell lung cancer
    115893541
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115893541
   05012 Parkinson disease
    115893541
   05014 Amyotrophic lateral sclerosis
    115893541
   05016 Huntington disease
    115893541
   05017 Spinocerebellar ataxia
    115893541
   05020 Prion disease
    115893541
   05022 Pathways of neurodegeneration - multiple diseases
    115893541
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115893541
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115893541
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115893541
   05134 Legionellosis
    115893541
   05152 Tuberculosis
    115893541
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115893541
   05161 Hepatitis B
    115893541
   05160 Hepatitis C
    115893541
   05164 Influenza A
    115893541
   05162 Measles
    115893541
   05168 Herpes simplex virus 1 infection
    115893541
   05163 Human cytomegalovirus infection
    115893541
   05167 Kaposi sarcoma-associated herpesvirus infection
    115893541
   05169 Epstein-Barr virus infection
    115893541
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115893541
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115893541
SSDB
Motif
Pfam: Cytochrom_C
Other DBs
NCBI-GeneID: 115893541
NCBI-ProteinID: XP_030773590
LinkDB
Position
15
AA seq 113 aa
MDIKILLIKNKFGSRKKIFVQKCAHGHTVEKGGQHKTGPNLHSLFGWKTGEAVGFSYTDT
SKNKGITWGKDTLMHYLEAPKNNIPGTKIISAGIKKKAERADLITNLKNATNE
NT seq 342 nt   +upstreamnt  +downstreamnt
atggacataaaaattctacttattaagaacaagtttggctctcgcaagaagatttttgtt
cagaagtgtgcccacggccacacggtggaaaagggaggccagcacaagactgggcctaat
ctccatagtctcttcgggtggaagacaggagaagctgttggattctcttacacagacacc
agtaagaacaaaggcatcacctggggaaaggatacactgatgcactatttggaggctccc
aagaacaacatcccgggaacaaaaattatctctgccggcattaagaagaaggcagaaagg
gcagacttgataactaatctcaaaaacgctactaatgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115894533
Entry
115894533         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115894533
   04215 Apoptosis - multiple species
    115894533
   04115 p53 signaling pathway
    115894533
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115894533
  09162 Cancer: specific types
   05210 Colorectal cancer
    115894533
   05222 Small cell lung cancer
    115894533
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115894533
   05012 Parkinson disease
    115894533
   05014 Amyotrophic lateral sclerosis
    115894533
   05016 Huntington disease
    115894533
   05017 Spinocerebellar ataxia
    115894533
   05020 Prion disease
    115894533
   05022 Pathways of neurodegeneration - multiple diseases
    115894533
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115894533
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115894533
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115894533
   05134 Legionellosis
    115894533
   05152 Tuberculosis
    115894533
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115894533
   05161 Hepatitis B
    115894533
   05160 Hepatitis C
    115894533
   05164 Influenza A
    115894533
   05162 Measles
    115894533
   05168 Herpes simplex virus 1 infection
    115894533
   05163 Human cytomegalovirus infection
    115894533
   05167 Kaposi sarcoma-associated herpesvirus infection
    115894533
   05169 Epstein-Barr virus infection
    115894533
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115894533
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115894533
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF3365
Other DBs
NCBI-GeneID: 115894533
NCBI-ProteinID: XP_030777790
LinkDB
Position
18
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTMEKGGKQKTGPNLHGLFGWKTGQAIGFSYIDTGKNKGITW
GNDTLREYLENPRKYVPGTKMIFAGIKMKAERADLLAYLKKATSE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacacc
atggaaaagggaggcaagcaaaagactgggcctaatctccatggtctcttcgggtggaag
acaggtcaggccattggattctcttacatagacaccggtaagaacaaaggcatcacctgg
ggaaatgatacactgagggagtatttggagaatcccaggaaatacgttcctggaacaaaa
atgatctttgccggcattaagatgaaggcagaaagggcagacttgttagcttatctcaaa
aaagctacaagtgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115898126
Entry
115898126         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115898126
   04215 Apoptosis - multiple species
    115898126
   04115 p53 signaling pathway
    115898126
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115898126
  09162 Cancer: specific types
   05210 Colorectal cancer
    115898126
   05222 Small cell lung cancer
    115898126
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115898126
   05012 Parkinson disease
    115898126
   05014 Amyotrophic lateral sclerosis
    115898126
   05016 Huntington disease
    115898126
   05017 Spinocerebellar ataxia
    115898126
   05020 Prion disease
    115898126
   05022 Pathways of neurodegeneration - multiple diseases
    115898126
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115898126
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115898126
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115898126
   05134 Legionellosis
    115898126
   05152 Tuberculosis
    115898126
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115898126
   05161 Hepatitis B
    115898126
   05160 Hepatitis C
    115898126
   05164 Influenza A
    115898126
   05162 Measles
    115898126
   05168 Herpes simplex virus 1 infection
    115898126
   05163 Human cytomegalovirus infection
    115898126
   05167 Kaposi sarcoma-associated herpesvirus infection
    115898126
   05169 Epstein-Barr virus infection
    115898126
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115898126
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115898126
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 115898126
NCBI-ProteinID: XP_030787682
LinkDB
Position
6
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEEREDLIAYLRKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg
ggagaggacacactgatggaatatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggaagacttgatagcttatctcaga
aaagctactaatgagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115899152
Entry
115899152         CDS       T03989                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05222  Small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115899152
   04215 Apoptosis - multiple species
    115899152
   04115 p53 signaling pathway
    115899152
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115899152
  09162 Cancer: specific types
   05210 Colorectal cancer
    115899152
   05222 Small cell lung cancer
    115899152
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115899152
   05012 Parkinson disease
    115899152
   05014 Amyotrophic lateral sclerosis
    115899152
   05016 Huntington disease
    115899152
   05017 Spinocerebellar ataxia
    115899152
   05020 Prion disease
    115899152
   05022 Pathways of neurodegeneration - multiple diseases
    115899152
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115899152
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115899152
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115899152
   05134 Legionellosis
    115899152
   05152 Tuberculosis
    115899152
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115899152
   05161 Hepatitis B
    115899152
   05160 Hepatitis C
    115899152
   05164 Influenza A
    115899152
   05162 Measles
    115899152
   05168 Herpes simplex virus 1 infection
    115899152
   05163 Human cytomegalovirus infection
    115899152
   05167 Kaposi sarcoma-associated herpesvirus infection
    115899152
   05169 Epstein-Barr virus infection
    115899152
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115899152
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115899152
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 115899152
NCBI-ProteinID: XP_030792066
LinkDB
Position
8
AA seq 104 aa
MGNVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGQKPGQAIGFSYTDANKNKCITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKVEKADLTAYLKKATN
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtaatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgtcacacc
gtggaaaagggaggcaagcacaagactgggcctaatctccatggtctcttcgggcagaag
ccaggtcaggccattggattctcttacacagatgccaataagaacaaatgcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgccggcattaaaaagaaggtagaaaaggccgacttgacagcttatctcaaa
aaagctactaattag

DBGET integrated database retrieval system