KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661791
Entry
104661791         CDS       T03989                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04152  AMPK signaling pathway
rro04218  Cellular senescence
rro04914  Progesterone-mediated oocyte maturation
rro05161  Hepatitis B
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104661791 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104661791 (CCNA2)
   04218 Cellular senescence
    104661791 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104661791 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104661791 (CCNA2)
   05202 Transcriptional misregulation in cancer
    104661791 (CCNA2)
   05203 Viral carcinogenesis
    104661791 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104661791 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661791 (CCNA2)
   05161 Hepatitis B
    104661791 (CCNA2)
   05169 Epstein-Barr virus infection
    104661791 (CCNA2)
   05165 Human papillomavirus infection
    104661791 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104661791 (CCNA2)
   03036 Chromosome and associated proteins [BR:rro03036]
    104661791 (CCNA2)
DNA replication proteins [BR:rro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104661791 (CCNA2)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104661791 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104661791
NCBI-ProteinID: XP_010360864
UniProt: A0A2K6Q6A5
LinkDB
Position
2
AA seq 432 aa
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKAGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKETQKKPAESQKT
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANSKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcaactccgcgcccgggcctgcgacccgcgaggcgggctcggcgctgctagca
ttgcagcagactgcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccagcaaccgcggacccgagccgcgctggcggtactgaaggccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgcgacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagagactcagaagaagcccgctgaatctcaaaaaacg
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtacctcttgattatccaatggatggcagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacgtaccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctttcttccatgtcagtgctgagaggaaagcttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaacagcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctaaagtatttgccatcagttattgctggagccgccttt
catttagcactctacacagtcacaggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gctccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctcttctcaacccaccagagacactaaatctgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677942
Entry
104677942         CDS       T03989                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1 isoform X1
  KO
K06627  cyclin-A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04152  AMPK signaling pathway
rro04218  Cellular senescence
rro04914  Progesterone-mediated oocyte maturation
rro05161  Hepatitis B
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104677942 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104677942 (CCNA1)
   04218 Cellular senescence
    104677942 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104677942 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677942 (CCNA1)
   05202 Transcriptional misregulation in cancer
    104677942 (CCNA1)
   05203 Viral carcinogenesis
    104677942 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104677942 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677942 (CCNA1)
   05161 Hepatitis B
    104677942 (CCNA1)
   05169 Epstein-Barr virus infection
    104677942 (CCNA1)
   05165 Human papillomavirus infection
    104677942 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104677942 (CCNA1)
   03036 Chromosome and associated proteins [BR:rro03036]
    104677942 (CCNA1)
DNA replication proteins [BR:rro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104677942 (CCNA1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104677942 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 104677942
NCBI-ProteinID: XP_010381400
UniProt: A0A2K6Q2J3
LinkDB
Position
18
AA seq 465 aa
METGFPAVMYPGSFIGGWGDEYLCWGRPGLPDFSFQQQPVESEAMHCSNPKNGVVLATVA
RGPDACQILTRAPLGQDPAQRTVLGLLTENGQYRRTCGQGSTRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDGDNCSGREGMAFEDVYEVDSSTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVTNVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKAPKYLHVSLMEPPSVLLLQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggagaccggctttcccgcagtcatgtaccctggatcttttattgggggctggggagat
gagtatctctgctggggaagaccggggctcccagatttcagcttccagcagcagcctgtg
gagtctgaggcaatgcactgcagcaaccccaagaatggagttgtgctggctacagtggcc
cgaggtcccgatgcttgtcagatactcaccagagccccgctgggccaggatcccgcgcag
aggacagtgctagggctgctaactgaaaatgggcagtacaggaggacctgtggccagggg
tccacaagaatcaggtgttattctggatcagaaaatgccttccctccagctggaaagaaa
gcgctccctgactgtggggtccaagagccccccaagcaagggtttgacatctacatggat
gaactagagcagggggacggagacaactgttcgggcagagaggggatggcatttgaggat
gtgtatgaagtagacagcagcacactcaagtcagacctgcacttcctgctggatttcaac
acagtttctcctatgctggtagattcatctctgctctcccagtctgaagatatatccagt
cttggcacagacgtgacaaatgtgactgaatacgctgaagaaatttatcagtaccttagg
gaagctgaaataaggcacagacccaaagcgcactacatgaagaagcagccggacatcacg
gaaggcatgcgcacgattctggtggactggctggtggaggttggggaagaatataagctt
cgagcagagaccctgtatctggctgtcaacttcctggacaggttcctttcatgtatgtct
gttctgagagggaaactgcagctcgtgggaacagcagctattcttttggcttcgaaatat
gaagagatatatcctcctgaagtagatgagtttgtctatatcactgatgatacatacaca
aaacgacaactgttaaaaatggagcacttgcttctgaaagttctagcttttgatctgaca
gtgccaaccaccaaccagtttctccttcagtacttgaggcgacaaggagtgtgcgtcagg
actgaaaacctggctaagtatgtagcagagctgagtctacttgaagcagacccattcttg
aaataccttccttcattgatagctgcagcagctttttgcctggcaaactatactgtgaac
aagcacttttggccggaaacccttgctgcatttacagggtattcattaagtgaaattgtg
ccttgcctgagtgagcttcataaagcgtaccttgatataccccatcgacctcagcaagca
attagggagaagtacaaggctccaaagtacctgcatgtgtccctcatggagccaccttca
gttcttcttctacaataa

DBGET integrated database retrieval system