KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661825
Entry
104661825         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro03320  PPAR signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04931  Insulin resistance
rro04960  Aldosterone-regulated sodium reabsorption
rro05145  Toxoplasmosis
rro05205  Proteoglycans in cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05223  Non-small cell lung cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104661825
   04071 Sphingolipid signaling pathway
    104661825
   04151 PI3K-Akt signaling pathway
    104661825
   04152 AMPK signaling pathway
    104661825
   04150 mTOR signaling pathway
    104661825
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104661825
  09143 Cell growth and death
   04210 Apoptosis
    104661825
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104661825
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104661825
   04664 Fc epsilon RI signaling pathway
    104661825
  09152 Endocrine system
   04910 Insulin signaling pathway
    104661825
   03320 PPAR signaling pathway
    104661825
   04919 Thyroid hormone signaling pathway
    104661825
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104661825
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104661825
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104661825
   05231 Choline metabolism in cancer
    104661825
  09162 Cancer: specific types
   05215 Prostate cancer
    104661825
   05213 Endometrial cancer
    104661825
   05223 Non-small cell lung cancer
    104661825
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104661825
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104661825
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104661825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104661825
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104661825
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104661825
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   104661825
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    104661825
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Kdo YukC
Other DBs
NCBI-GeneID: 104661825
NCBI-ProteinID: XP_030780554
LinkDB
Position
20
AA seq 336 aa
MGLHSLYVIEAAGMEVVLWHYDAVPIQSSVVLCSCPSPSMVRTQTESSTAPGIPGGSRQG
PTMDGTAAEPRPGAGPLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREY
AIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELL
KYIRKIGSFDETCTRFYTAEXVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAK
VLSPESKQARANSFVGTAQYVSPELLTEKSACKRFYMRTHGVAQQELLKPRPNRLSEDTS
AQLGAWNYGQRGCGKAADVWTKHLHTSPWATSSDCR
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgggactgcattcgctttacgtcattgaagctgctggcatggaagtggtgctgtggcat
tatgacgccgtgcccatccagtccagcgtggtgttatgttcctgcccatccccatcaatg
gtgaggacccagactgagtccagcacggcccctggcattcctggtggcagcaggcagggc
cccaccatggacggcaccgcagccgagcctcggcccggtgccggccccctgcagcacgcc
cagcctccaccgcagcctcggaagaagcggcctgaggacttcaagtttgggaaaattctt
ggggaaggctctttttccacggttgtcctggctcgagaactggcaacctccagagaatat
gcgattaaaattctggagaaacgacatatcataaaagagaacaaagtcccgtatgtaacc
agagagcgggatgtcatgtcgcgcctggatcaccccttctttgttaagctttacttcacg
tttcaggacgacgagaagctgtatttcggccttagttatgccaaaaacggagaactactt
aaatatattcgcaaaatcggttcattcgatgagacctgtactcgattttacacggctgag
natgtgtctgctttagagtacttgcacggcaagggcatcattcacagggaccttaaaccg
gaaaacattttgttaaatgaagatatgcacatccagatcacagattttggaacagcaaag
gtcttatccccagagagcaaacaagccagggccaactcattcgtgggaacagcgcagtac
gtttctccagagctgctcacggagaagtccgcctgtaagagattttacatgaggacccat
ggcgtggcccagcaggagttgctcaagccccgtcctaacaggctttctgaggacacatca
gcccagctgggcgcctggaattacgggcagaggggctgtggcaaggcggccgatgtgtgg
actaaacacctgcacacgtcaccctgggcaacctcgagtgactgccggtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682713
Entry
104682713         CDS       T03989                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro03320  PPAR signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04510  Focal adhesion
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04931  Insulin resistance
rro04960  Aldosterone-regulated sodium reabsorption
rro05145  Toxoplasmosis
rro05205  Proteoglycans in cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05223  Non-small cell lung cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104682713 (PDPK1)
   04071 Sphingolipid signaling pathway
    104682713 (PDPK1)
   04151 PI3K-Akt signaling pathway
    104682713 (PDPK1)
   04152 AMPK signaling pathway
    104682713 (PDPK1)
   04150 mTOR signaling pathway
    104682713 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104682713 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    104682713 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104682713 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104682713 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    104682713 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104682713 (PDPK1)
   03320 PPAR signaling pathway
    104682713 (PDPK1)
   04919 Thyroid hormone signaling pathway
    104682713 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104682713 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104682713 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104682713 (PDPK1)
   05231 Choline metabolism in cancer
    104682713 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104682713 (PDPK1)
   05213 Endometrial cancer
    104682713 (PDPK1)
   05223 Non-small cell lung cancer
    104682713 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104682713 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104682713 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104682713 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682713 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104682713 (PDPK1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104682713 (PDPK1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   104682713 (PDPK1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    104682713 (PDPK1)
SSDB
Motif
Pfam: PH_3 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 104682713
NCBI-ProteinID: XP_030780316
LinkDB
Position
20
AA seq 345 aa
MPSVERVTRQNALDIGVQLALQRVSARANSFVGTAQYVSPELLTEKSACKSSDLWALGCI
IYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEME
GYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSS
SSSHSLSASDVGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQF
VENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNF
KTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgccttccgttgagcgggtgacacggcagaatgcgctggacattggtgtgcagctcgct
ctccagcgcgtgtcggccagggccaactcattcgtgggaacagcgcagtacgtttctcca
gagctgctcacggagaagtccgcctgtaagagttcagacctttgggctcttggatgcata
atataccagcttgtggcaggactcccaccattccgagctggaaacgagtatcttatattt
cagaagatcattaagttggaatatgactttccagaaaaattcttccctaaggcaagagac
ctcgtggagaaacttttggttttagatgccacaaagcggttaggctgtgaggaaatggaa
gggtatggacctcttaaagcacacccattcttcgagtctgtcacgtgggagaacctgcac
cagcagacgcctccgaagctcaccgcttacctgccggccatgtcagaagacgacgaggac
tgctatggcaattatgacaatctcctgagccagtttggctgcatgcaggtgtcctcatcc
tcctcctcacactccttgtcagcctcggacgtgggcctgccccagaggtcaggcagcaac
atagagcagtacatccacgatctggactcgaactcctttgaactggacttacagttttcc
gaagatgagaagaggttgttattggagaagcaggctggcggaaacccttggcaccagttt
gtagaaaataatttaatactaaagatgggcccggtggataagcggaagggtttattcgca
cgacgacgacagttgttgctcacagaaggaccacatttatattacgtggatcctgtcaac
aaagtcctgaaaggtgaaattccttggtcacaagaacttcgaccagaggccaagaatttt
aaaacgttctttgtccacacgcctaaccggacgtattatctgatggaccccagtgggaac
gcacacaagtggtgcaggaagatccaggaggtttggaggcagcgataccagagccaccca
gacgccgctgtgcagtga

DBGET integrated database retrieval system