KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661875
Entry
104661875         CDS       T03989                                 

Gene name
TNNT2
Definition
(RefSeq) troponin T, cardiac muscle isoform X11
  KO
K12045  troponin T, cardiac muscle
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104661875 (TNNT2)
   04261 Adrenergic signaling in cardiomyocytes
    104661875 (TNNT2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104661875 (TNNT2)
   05414 Dilated cardiomyopathy
    104661875 (TNNT2)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     104661875 (TNNT2)
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 104661875
NCBI-ProteinID: XP_010360991
UniProt: A0A2K6NDB0
LinkDB
Position
1
AA seq 292 aa
MSDMEEVVEEYEEEEQEEAAVEEQEEAAEEDAEDGAEAEAETEETRAEEDGEEEEAKEAE
DGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKE
EEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKK
ALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKEL
WQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtctgacatggaagaggtggtggaagagtacgaggaggaggagcaggaagaagcagct
gttgaagagcaggaggaggcagcagaagaggatgctgaggatggggctgaagcagaggct
gagaccgaggagaccagggcagaagaagatggagaagaagaggaagcaaaggaagctgaa
gatggcccaatggaggagtccaaacccaagcccaggtcattcatgcccaacttggtgcct
cccaagatccccgatggagagagagtggactttgatgacatccaccggaagcgcatggag
aaggacctgaatgagttgcaggcgctgatcgaggctcactttgagaacaggaagaaggag
gaggaggagctcgtttctctgaaggacaggatcgagagacgtcgggcagagcgggccgag
cagcagcgcatccggaatgagcgggagaaggagcggcagaaccgcctggctgaagagagg
gctcgacgagaggaggaggagaaccggaggaaggctgaggatgaggcccggaagaagaag
gctttgtccaacatgatgcattttgggggttacatccagaagcaggcccagacagagcgg
aaaagtgggaagaggcagaccgagcgggaaaagaagaagaagattctggccgagaggagg
aaggtgctggccatcgaccacctgaatgaagatcagttgagggagaaggctaaggagcta
tggcagagcatctataacttggaggcagagaagttcgacctgcaggagaagttcaagcag
cagaaatacgagatcaatgttctccgaaacaggatcaacgataaccagaaagtctccaag
acccgcgggaaggccaaagtcactgggcgctggaagtag

DBGET integrated database retrieval system