KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661905
Entry
104661905         CDS       T03989                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104661905
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104661905
   04145 Phagosome
    104661905
  09143 Cell growth and death
   04218 Cellular senescence
    104661905
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104661905
   04612 Antigen processing and presentation
    104661905
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104661905
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104661905
   05330 Allograft rejection
    104661905
   05332 Graft-versus-host disease
    104661905
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104661905
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104661905
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661905
   05170 Human immunodeficiency virus 1 infection
    104661905
   05168 Herpes simplex virus 1 infection
    104661905
   05163 Human cytomegalovirus infection
    104661905
   05167 Kaposi sarcoma-associated herpesvirus infection
    104661905
   05169 Epstein-Barr virus infection
    104661905
   05165 Human papillomavirus infection
    104661905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104661905
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104661905
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104661905
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104661905
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C MHC_I_3 Ig_3 ig Darcynin
Other DBs
NCBI-GeneID: 104661905
NCBI-ProteinID: XP_030785403
LinkDB
Position
4
AA seq 334 aa
MRYFGTSVSRPGRGEPHFIYVAYVDDTQFVRFDSDAAIPRMEPLAPWVEPEYWERETRGA
KTHAENFQANLRTLLRYYNPSEAGSHTTQEMYGCDLGPDGRFLRGYDQLAYDGKDYLALK
EDLRSWTAADTAAQISRRKWEVTREAERVRAYLEDRCLEWLHRHLENGKETLQRADPPKT
HVTHHRISDHEATLRCWALGFYPAEITLTWQWDGEDRTQDTELVETRPAGDGTFQKWGAV
VVPSGEEQRYTCHVQHEGLLEPLTLRWEPSSQPTILIAAIIAGLIVLGAVVTGAGVAAVM
WRKKSSGGKGGSYSQAVWSNGAQGSDVSLRDCKA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaggtatttcggcacctcagtgtcccggcccggccgcggggagccccacttcatctac
gtggcctacgtggacgacacgcagttcgtgcgattcgacagcgacgcggcgattccgagg
atggagccgctggcgccgtgggtggagccggagtattgggagcgggagacacgaggcgcc
aagacccacgcagagaatttccaagcgaacctgcggaccctgctccgctactacaacccg
agcgaggccgggtctcacaccacccaggagatgtatggctgcgacctggggccagatggg
cgcttcctacgcgggtacgaccagttagcctacgacggcaaggattacctcgccctgaag
gaggacctgcgctcctggaccgcagcggacaccgcggctcagatctcccggcgcaagtgg
gaggtgacccgtgaggcggagagggtgagagcctacctggaggacaggtgcctggagtgg
ctccacagacacctggagaacgggaaggagacgctgcagcgcgcggatcccccaaagaca
catgtgacccaccaccgcatctctgaccatgaggccaccctgaggtgctgggccctgggc
ttctaccctgcggaaatcacactgacctggcagtgggatggggaggaccgaactcaggac
acggagcttgtggagaccaggccggcaggggatggaaccttccagaagtggggagctgtg
gtggtgccttctggagaggagcagagatacacgtgccatgtgcagcatgaggggttgttg
gagcccctcaccctgagatgggagccgtcttcccagcccaccatcctcatcgcagccatc
attgctggcctgattgtccttggagctgtggtcactggagctggggttgctgctgtgatg
tggaggaagaaaagctcaggtggaaaaggagggagctactctcaggctgtgtggagcaat
ggtgcccagggctctgatgtgtctctcagggattgtaaagcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666183
Entry
104666183         CDS       T03989                                 

Definition
(RefSeq) popy class I histocompatibility antigen, alpha chain E isoform X1
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104666183
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104666183
   04145 Phagosome
    104666183
  09143 Cell growth and death
   04218 Cellular senescence
    104666183
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104666183
   04612 Antigen processing and presentation
    104666183
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104666183
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104666183
   05330 Allograft rejection
    104666183
   05332 Graft-versus-host disease
    104666183
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104666183
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104666183
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104666183
   05170 Human immunodeficiency virus 1 infection
    104666183
   05168 Herpes simplex virus 1 infection
    104666183
   05163 Human cytomegalovirus infection
    104666183
   05167 Kaposi sarcoma-associated herpesvirus infection
    104666183
   05169 Epstein-Barr virus infection
    104666183
   05165 Human papillomavirus infection
    104666183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104666183
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104666183
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104666183
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104666183
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 104666183
NCBI-ProteinID: XP_010366495
LinkDB
Position
4
AA seq 359 aa
MALRTLLLLLSALTKTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAAS
PRMEPRASWIEQEGPEYWDQETRSARDTAQTFRVNLKTLRGYYNQSEAASHTLQWMHGCD
LGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWSAVDTAAQISEQKSNDGSETEHQRVYLED
TCVEWLRKYLEKGKETLQYLNPPKTHVTHHPVSDHEATLRCWALGFYPAEITVTWQRDGE
DQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPCI
PIMGIITGLVLLGAVVTGAVVAAVMWRRKSSGRKGGSYSQAVCSDSAQGSDESLIAYKA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcactaagaaccctacttctcctgctctcggcccttaccaagacctgggcgggctcc
cactccttgaagtatttccacacttccgtgtcccggcccggccgcggggagccccgcttc
atctccgtgggctacgtggacgacacgcagtttgtgcggttcgacagcgacgccgcgagt
ccgaggatggagccgcgggcgtcgtggatagagcaggaggggccggagtattgggaccag
gagacacggagcgccagagacaccgcacagactttccgagtgaacctgaagaccctgcgc
ggctactacaaccagagcgaggccgcgtctcataccctccagtggatgcatggctgcgac
ctggggccggacgggcgcttcctccgagggtatgaacagttcgcctacgacggcaaggat
tatctcaccctgaatgaggacctgcgctcctggtccgcggtggacacggcggctcaaatc
tccgagcaaaagtcaaatgatggctctgagacggagcaccagagagtctacctggaagac
acatgcgtggagtggctccgcaaatacctggagaagggaaaggagacgctgcagtacctg
aacccccccaagacacatgtgacccaccaccccgtctctgatcatgaggccaccctgagg
tgctgggccctgggcttctaccctgcggagatcacagtgacctggcagcgggatggggag
gaccagacccaggacacggagcttgtggagaccaggcctgcaggggatggaaccttccag
aagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcag
catgaggggctgccggagcccctcaccctgagatgggagccgtcttcccaaccctgcatc
ccaatcatgggcatcattactggcctggttctccttggagctgtggtcactggagctgtg
gttgctgctgtgatgtggaggaggaagagctcaggtagaaaaggagggagctactctcag
gctgtgtgtagcgacagtgcccagggatctgatgagtctctcatagcttataaagcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668193
Entry
104668193         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-42 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104668193
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104668193
   04145 Phagosome
    104668193
  09143 Cell growth and death
   04218 Cellular senescence
    104668193
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104668193
   04612 Antigen processing and presentation
    104668193
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104668193
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104668193
   05330 Allograft rejection
    104668193
   05332 Graft-versus-host disease
    104668193
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104668193
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104668193
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668193
   05170 Human immunodeficiency virus 1 infection
    104668193
   05168 Herpes simplex virus 1 infection
    104668193
   05163 Human cytomegalovirus infection
    104668193
   05167 Kaposi sarcoma-associated herpesvirus infection
    104668193
   05169 Epstein-Barr virus infection
    104668193
   05165 Human papillomavirus infection
    104668193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104668193
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104668193
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104668193
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104668193
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 104668193
NCBI-ProteinID: XP_030785401
LinkDB
Position
4
AA seq 406 aa
MRVMAPRTLLLLLSGALALTETWAGSHSLRYFHTAVSRPGRGEPHFISVGYVDDTQFVRF
DSDAESPREEPRAPWAEQEGPEYWEEQTPRAKAHAQAHRVNLRNLLRYYNQSDAGSHTIQ
WMYGCDLGPDGRLLRGHEQYAYDGKDYIALNEDLRSWTAADMAAQNTQRKWEAARAAEQD
RAYLEGTCVESLRRFLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSDSAQGSDVSH
GLKSLRQLSCVGLRCRISSRLXFCDFKRLWHLFLQRHLNVSASLLA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccttgaggtatttccacaccgccgtgtcccggcccggc
cgcggggagccccacttcatctccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgagagaggagccgcgggcgccgtgggcggagcaggagggg
ccggagtattgggaagagcagacaccgagagccaaggcccacgcacaggctcaccgagtg
aacctgcggaacctgctccgctactacaaccagagcgatgccgggtctcacaccatccag
tggatgtatggctgcgacctgggacccgacgggcgcctcctccgcgggcatgaacagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgttcctggaccgccgcg
gacatggcggctcagaacacccagcgcaagtgggaggcggcccgtgcggcggagcaggac
agagcctacctggaggggacgtgcgtagagtcgctccgcagattcctagagaacgggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggagcaaactcaggacaccgagcttgtggagaccaggccagga
ggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgccagaacccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcgacagtgcccagggctctgatgtctctcac
ggcttgaaaagcctgagacaactgtcttgtgtgggactgagatgcaggatttcttcacgc
ctcnccttttgtgacttcaagagactctggcatctctttctgcaaaggcatctgaatgtg
tctgcttctctgttagcataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668434
Entry
104668434         CDS       T03989                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-30 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104668434
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104668434
   04145 Phagosome
    104668434
  09143 Cell growth and death
   04218 Cellular senescence
    104668434
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104668434
   04612 Antigen processing and presentation
    104668434
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104668434
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104668434
   05330 Allograft rejection
    104668434
   05332 Graft-versus-host disease
    104668434
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104668434
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104668434
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104668434
   05170 Human immunodeficiency virus 1 infection
    104668434
   05168 Herpes simplex virus 1 infection
    104668434
   05163 Human cytomegalovirus infection
    104668434
   05167 Kaposi sarcoma-associated herpesvirus infection
    104668434
   05169 Epstein-Barr virus infection
    104668434
   05165 Human papillomavirus infection
    104668434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104668434
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104668434
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104668434
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104668434
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 104668434
NCBI-ProteinID: XP_030783950
LinkDB
Position
4
AA seq 346 aa
MAVMAPRTLLLVLSGALALTQTRAGSHSMRYFYTYMSRPGRGEPRFISVAYVDDTQFVRF
DSDAASQRMEPRAPWVEQEGPEYWDRSTRIMKAETQNAPVNLRNLRRYYNQSEAGSHTIQ
NMYGCDLGPDGRLLRGYDQHAYDGRDYIALNEDLRSWTAADMAAQNTQRKWETEGWAERY
RAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHETTLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPTGDGTFQKWAAVVVPSGKEQRYTCHVQHEGLREPLTLRWEP
SSQSTIPIMAIIAGLVLLGAVVIGAEVAAVMWRKKSSGREGVRGGV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggttatggcgcccagaaccctcctcctggtgctctcaggggccctggccctgacc
cagacccgggcaggctcccactccatgaggtatttctacacctacatgtcccggcccggc
cgcggggagccccgcttcatctccgtggcctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccggagcacacggatcatgaaggccgagacacagaatgccccagtg
aacctgcggaacctgcgccgctactacaaccagagcgaggccgggtctcacaccatccag
aacatgtacggctgcgacctggggcccgacggacgcctcctccgcgggtatgaccagcac
gcctacgacggcagggattacatcgccctgaacgaggacctgcgctcctggacggccgcg
gacatggcggctcagaacacccagcggaagtgggagacggaaggttgggcggagcggtac
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagacccccccaagacacatgtgacccaccaccccatctctgac
catgagaccaccctgaggtgctgggccctaggcttctatcctgcggagatcacactgacc
tggcagcgggatggagaggaccaaactcaggacacggagctcgtggagaccaggcctaca
ggggatggaaccttccagaagtgggcggctgtagtggtgccttctggaaaggagcagaga
tacacctgtcatgtgcagcatgagggtctgcgtgagcccctcaccctgagatgggagccg
tcttcccagtccaccatccccatcatggccatcattgctggcctggttctccttggagct
gtggtcattggagctgaggtcgctgctgtaatgtggaggaagaaaagctcaggtagggaa
ggggtgaggggtggggtctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670209
Entry
104670209         CDS       T03989                                 

Definition
(RefSeq) patr class I histocompatibility antigen, B-2 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104670209
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104670209
   04145 Phagosome
    104670209
  09143 Cell growth and death
   04218 Cellular senescence
    104670209
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104670209
   04612 Antigen processing and presentation
    104670209
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104670209
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104670209
   05330 Allograft rejection
    104670209
   05332 Graft-versus-host disease
    104670209
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104670209
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104670209
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104670209
   05170 Human immunodeficiency virus 1 infection
    104670209
   05168 Herpes simplex virus 1 infection
    104670209
   05163 Human cytomegalovirus infection
    104670209
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670209
   05169 Epstein-Barr virus infection
    104670209
   05165 Human papillomavirus infection
    104670209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104670209
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104670209
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104670209
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104670209
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 MHC_I_3 ig C2-set_2
Other DBs
NCBI-GeneID: 104670209
NCBI-ProteinID: XP_030785396
LinkDB
Position
4
AA seq 457 aa
MKFPVDTRDASQFPLSLGVGCLEKPISVAAVPVLKSSRAHPDSVSSDAEMSVMAPRTLLL
LLSEALALTETWAGKCGAGREMASAGRREATAGGDAGPDVPRGEEGRAGLSLSSRPGSHS
MRYFSTVVSRPGRGEPRFISVGYVDDTQFVWFDSDAASPRMEPRAPWVEQEGPEYWEEQT
GFAKAYAQTHRVSLRNLLRYYNQSEAGSHTIQWMYGCDLGPHGRLLRGYEQYAYDGKDYI
ALNEDLRSWTAADMAAQNTQRKWEADRLAEQLRPYLEGQCPEWLRRYLENGKKTLQRADP
PKTHVTHHLLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPVGDGTFQKW
GAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTIPIVGIVAGLAVLAVMVTGAVVA
AVMWRRKSSGGKGGSYSQAASSDSAQGSDVSLTASKA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaagttccccgtggatactcgtgacgcgtcccagttcccactctcattgggtgtcgga
tgtctagagaagccaatcagcgtcgccgcggtcccagttctaaagtcctcacgggcccat
ccggactcagtctcctcagacgccgagatgtcagtcatggcgcctcgaaccctcctgctg
ctgctctcggaggccctggccctgaccgagacctgggccggtaagtgcggggccgggagg
gaaatggcctctgcggggaggagagaggcgaccgcaggcggggacgcaggaccggatgtg
ccgcgcggggaggagggtcgggcgggtctcagcctctcctcgcgcccaggctcgcactcc
atgaggtatttcagcaccgtcgtgtcccggcccggccgcggggagccccgcttcatatcc
gtgggctacgtggacgacacgcagttcgtgtggttcgacagcgacgccgcgagtccgagg
atggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaagagcagaca
gggttcgccaaggcctacgcacagactcaccgagtgagcctacggaacctgctccgctac
tacaaccagagcgaggccgggtctcacaccatccagtggatgtatggctgcgacctgggg
ccccacgggcgcctcctccgcgggtatgaacagtacgcctacgatggcaaggattacatc
gccctgaacgaggacctgcgctcctggaccgccgcggacatggcagctcagaacacccag
cgcaagtgggaggcagaccgtttggcggagcaactgagaccctacctggagggccagtgc
ccggagtggctccgcagatacctggagaacgggaagaagacgctgcagcgcgcggacccc
ccaaagacacacgtgacccaccacctcctctctgaccacgaggccaccctgaggtgctgg
gccctgggcttctaccctgcggagatcacactgacctggcagcgggatggggaggaccaa
actcaggacaccgagcttgtggagaccaggccagtaggagatggaaccttccagaagtgg
ggagctgtggtggtgccttctggagaagagcagagatacacgtgccatgtgcagcatgag
gggctgccggagcccctcaccctgagatgggagccatcttcccagtccaccatccccatc
gtgggcattgttgctggcctggctgtcctagcagttatggtcaccggagctgtggtcgct
gctgtgatgtggaggaggaagagctcaggtggaaaaggagggagctactctcaggctgcg
tccagcgacagtgcccagggctctgatgtgtctctcacggcttcaaaagcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673193
Entry
104673193         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-14 alpha chain
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104673193
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104673193
   04145 Phagosome
    104673193
  09143 Cell growth and death
   04218 Cellular senescence
    104673193
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104673193
   04612 Antigen processing and presentation
    104673193
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104673193
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104673193
   05330 Allograft rejection
    104673193
   05332 Graft-versus-host disease
    104673193
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104673193
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104673193
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104673193
   05170 Human immunodeficiency virus 1 infection
    104673193
   05168 Herpes simplex virus 1 infection
    104673193
   05163 Human cytomegalovirus infection
    104673193
   05167 Kaposi sarcoma-associated herpesvirus infection
    104673193
   05169 Epstein-Barr virus infection
    104673193
   05165 Human papillomavirus infection
    104673193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104673193
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104673193
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104673193
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104673193
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C MHC_I_3 C2-set_2
Other DBs
NCBI-GeneID: 104673193
NCBI-ProteinID: XP_030784120
LinkDB
Position
4
AA seq 518 aa
MSRKANQRRRGLSSKVPTRPPGLRVSSDTEMRVMGPRTFLLLLLAALALTETWAGSHSLR
YFSAGTSRPGRGEPHFISVGYVDDTQFLRFDSDAASPRMEPRAQWVEQEGPEYWEEQTGL
AKDVAXTFRVSLGTLRGYYNQSEADEXPRPGRRSRPLPTPDGRSGSPRVSWSEIRXQGHG
ARPDPRPGRAPGAFTRFHFQLRPKSSPVGPGGAGLGXAGMTAGAGPGSHTLRWMSGCDLG
PDGHLLRGYHQFAYDGKDYIALNGDLRSWTAADTAAQITQRKWEAAGVAEELRAYLEGTC
PDWLRRHLENGKETLQRADPPETHVTQHPVSDHEAILRCWALGFYPAEITLTWQRDGEDQ
TQDTELVDTRPAGDGIYQKWGAVVVRSGEEXRYTCHVQHEGLPEPLTLRWEPSSQSTIPI
MGIVAGLAVLAVVVTGAVVTAVMWRRKSSGGKGGSYSQAASSDSAQGSAVSHGLKSLRQL
SCVGLRCRISSLLXFCDFKRLWHLFLQRHLNVSASLLA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtctagaaaagccaatcagcgtcgccgcggtctcagttctaaagtccccacgcgccca
cccgggctcagagtctcctcagacaccgaaatgcgagtcatggggccccgaacctttctc
ctgctgctcttggcggccctggccctgaccgagacctgggccggctcgcactccttgagg
tatttcagcgccggcacgtcccggcccggccgcggggagccccacttcatctccgtgggc
tacgtggacgacacgcagttcctgcggttcgacagcgacgccgcgagtccaaggatggag
ccgcgggcgcagtgggtggagcaggaggggccggagtattgggaggagcagacagggctc
gccaaggacgtcgcatagactttccgagtgagcctggggaccctgcgcggctactacaac
cagagcgaggcggatgagtgaccccggccggggcgcaggtcacgacccctccccaccccc
gacggacggtccgggtctccccgagtctcctggtccgagatccgcntccaaggccacggg
gcccgcccagaccctcgaccggggagagccccaggcgcctttacccggtttcattttcag
ttgaggccaaagtcctcgccggttggtccgggcggggcggggctcggtngcgcggggatg
accgcgggggcggggccagggtctcacaccctccggtggatgtctggttgcgacctggga
cccgacgggcacctcctccgcgggtatcaccagttcgcctacgacggcaaggattacatc
gccttgaacggggacctgcgctcctggaccgcggcagacacggcggctcagatcacccag
cgcaagtgggaggcggccggtgtggcagaggagctgagagcttacctggaggggacgtgc
ccggattggctccgcagacacctggagaacgggaaggagacactgcagcgcgcagacccc
ccagagacacatgtgacccagcaccccgtctctgaccatgaggccatcctgaggtgctgg
gccctgggcttctaccctgcggagatcacactgacctggcagcgggatggggaggaccaa
actcaggacaccgagcttgtggacaccaggccagcaggagatggaatctaccagaagtgg
ggagctgtggtggtgcgttctggagaagagtagagatacacgtgccatgtgcagcatgag
ggattgccggagcccctcaccctgagatgggagccatcttcccagtccaccatccccatc
atgggcattgttgctggcctggctgtcctagcagttgtggtcactggagctgtggtcact
gctgtgatgtggaggaggaagagctcaggtggaaaaggagggagctactctcaggctgcg
tccagcgacagtgcccagggctctgctgtctctcacggcttgaaaagcctgagacaactg
tcttgtgtggggctgagatgcaggatttcttcactcctcnctttttgtgacttcaagaga
ctctggcatctctttctgcaaaggcatctgaatgtgtctgcatccctgttagcataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674706
Entry
104674706         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104674706
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104674706
   04145 Phagosome
    104674706
  09143 Cell growth and death
   04218 Cellular senescence
    104674706
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104674706
   04612 Antigen processing and presentation
    104674706
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104674706
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104674706
   05330 Allograft rejection
    104674706
   05332 Graft-versus-host disease
    104674706
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104674706
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104674706
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104674706
   05170 Human immunodeficiency virus 1 infection
    104674706
   05168 Herpes simplex virus 1 infection
    104674706
   05163 Human cytomegalovirus infection
    104674706
   05167 Kaposi sarcoma-associated herpesvirus infection
    104674706
   05169 Epstein-Barr virus infection
    104674706
   05165 Human papillomavirus infection
    104674706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104674706
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104674706
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104674706
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104674706
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig
Other DBs
NCBI-GeneID: 104674706
NCBI-ProteinID: XP_030785402
LinkDB
Position
4
AA seq 404 aa
MRVMAPRTLLLLLSGALALTETWAGSHSMRYFSTAVSRPGRGEPRFIDVGYVDDTQFVRF
DSDAASPRMEPRAPWIEQEGPEYWEEQTRISKANAQADRENLRTALRYYNQSEAGSHTLQ
RMSGCDLGPDGRLLRGYYQRAYDGKDYIALNEDLRSWTAADMAAQNTQRKWEAAGVAESR
RAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHYPVSDHETILRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTISIMGIVAGLAVLAVVVTGAVVAAVMRRRKSSGGKGGSYSQAASSDSAQGSDVSH
GLKSLRQLSCVELRSRISSRLPFEDXFWHLFLQRHLNVSASLLA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccatgaggtatttcagcaccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgacgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgaggatggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaagagcagacacggatctccaaggccaacgcacaggctgacagagag
aacctgcggaccgcgctccgctactacaaccagagcgaggccgggtctcacaccctccag
aggatgtctggctgcgacctgggacccgacgggcgcctcctccgcgggtattaccagcgc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacatggcggctcagaacacgcagcggaagtgggaggcggccggtgtggcagagagccgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggaccccccaaagacacacgtgacccactaccctgtctctgac
catgagaccatcctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccaaactcaggacactgagcttgtggagaccaggccagga
ggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggttgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatttctatcatgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgctgctgtgatgcggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcgacagtgcccagggctctgatgtctctcac
ggcttgaaaagcctgagacaactgtcttgtgtggaactgagaagcaggatttcttcacgc
ctcccttttgaagacnnattctggcatctctttctgcaaaggcatctgaatgtgtctgcg
tccctgttagcataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676771
Entry
104676771         CDS       T03989                                 

Definition
(RefSeq) mamu class I histocompatibility antigen, alpha chain F
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104676771
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104676771
   04145 Phagosome
    104676771
  09143 Cell growth and death
   04218 Cellular senescence
    104676771
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104676771
   04612 Antigen processing and presentation
    104676771
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104676771
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104676771
   05330 Allograft rejection
    104676771
   05332 Graft-versus-host disease
    104676771
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104676771
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104676771
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104676771
   05170 Human immunodeficiency virus 1 infection
    104676771
   05168 Herpes simplex virus 1 infection
    104676771
   05163 Human cytomegalovirus infection
    104676771
   05167 Kaposi sarcoma-associated herpesvirus infection
    104676771
   05169 Epstein-Barr virus infection
    104676771
   05165 Human papillomavirus infection
    104676771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104676771
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104676771
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104676771
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104676771
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 MHC_I_3 ig DUF357
Other DBs
NCBI-GeneID: 104676771
NCBI-ProteinID: XP_030783940
LinkDB
Position
4
AA seq 353 aa
MHPTGLRFSPDAEAGVMAPRTLLLMLSGALALTETWAGSHSLRYFSTAVSRPGRREPRYR
YIAVEYVDDTQFLRFDSDAAIPRMEQRAPWVEQEGPQYWERTTGYAKANAQTDRVALSNL
LLRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAR
ITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDREATL
RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHV
QHEGLPQPLTLRWEPSSQSTIPIVGISCWPGCPSSCGHWSCGCCCNVEEEELR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcaccctacgggactcagattctccccagacgcggaggctggggtcatggcgccccga
accctcctcctgatgctctcaggggccctggccctgaccgagacctgggcgggctcccac
tccttgcggtattttagcaccgctgtgtcgcggcctggccgcagggagcctcggtacagg
tacatcgcggtggagtacgtggacgacacgcagttcctgcggttcgacagcgacgccgcg
attccgaggatggagcagcgggcgccgtgggtggagcaagagggaccgcagtattgggag
cggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgagcaacctg
ctcctccgctacaaccagagcgaggccgggtctcacaccctccagggaatgaacggctgc
gacatgggccccgacggacgcctcctccgcgggtatcaccagcacgcctacgacggcaag
gattacatctccctgaacgaggacctgcgctcctggaccgccgcggacacggtagctagg
atcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggacctacctggag
ggcgagtgcctggagttgctccgcagatacctggagaacgggaaggagacgctacagcgc
gcagatcctccaaaggcacacgttgcccaccaccccatctctgaccgtgaggccaccctg
aggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgggacggg
gaggaacagacccaggacacggagctcgtggagaccaggcctgcaggggatggaaccttc
cagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgccatgtg
caacacgaagggctgccccagccccttaccctgagatgggagccatcttcccagtccacc
atccccatcgtgggcatcagttgctggcctggctgtcctagcagttgtggtcactggagc
tgtggttgctgctgtaatgtggaggaggaagagctcagatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676774
Entry
104676774         CDS       T03989                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104676774
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104676774
   04145 Phagosome
    104676774
  09143 Cell growth and death
   04218 Cellular senescence
    104676774
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104676774
   04612 Antigen processing and presentation
    104676774
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104676774
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104676774
   05330 Allograft rejection
    104676774
   05332 Graft-versus-host disease
    104676774
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104676774
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104676774
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104676774
   05170 Human immunodeficiency virus 1 infection
    104676774
   05168 Herpes simplex virus 1 infection
    104676774
   05163 Human cytomegalovirus infection
    104676774
   05167 Kaposi sarcoma-associated herpesvirus infection
    104676774
   05169 Epstein-Barr virus infection
    104676774
   05165 Human papillomavirus infection
    104676774
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104676774
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104676774
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104676774
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104676774
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig MHC_I_C
Other DBs
NCBI-GeneID: 104676774
NCBI-ProteinID: XP_030785443
LinkDB
Position
4
AA seq 381 aa
MMPGILLLLLSGALALTETRAGSHSLRYFSTSVSRPGRGEPRFISVGYVDDTQFLRFDSD
AASPRMEPRAPWVEQEGPEYWDRETRNAEGHAQTHRENLRTLLRYYNQSEAGSHTIQRVF
GCDLGPDGRLLRGYNQHAYDGKDYIALNQDLRSWTAADTAAQITQRKWEACGEAEEWSVY
LEGECLEWLRRYLEKGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEDQTEDTQLVETRPAGDGTFQKWAAVVVSSGEEQGYTCHVQHEGLPEPLTLRWEPSSQ
STIPIVGIVAGLAVLAFLVTGAVVAAVMWRRKSSGGKGGSYSQAACKWWGWVCGGAHPPH
NSSCPTSPAGSDQMLFLFYPS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgcccggaatcctccttctgctgctctcgggggccctggccctgaccgagacccgg
gcgggctcgcactccttgaggtatttcagcacctccgtgtcccggcccggccgcggggag
ccccgcttcatctccgtgggctacgtggacgacacgcagttcctgcggttcgacagtgac
gcggcgagtccgaggatggagccgcgagcgccgtgggtggagcaggaggggccggagtat
tgggaccgggagacgcggaacgccgagggccacgcacagactcaccgagagaacctgcgg
accctgctccgctactacaaccagagcgaggccgggtctcacaccatccagagggtgttt
ggctgcgacctggggcccgacgggcgcctcctccgcggatataaccagcacgcctacgat
ggcaaggattacatcgccctgaaccaggacctgcgctcctggaccgcggcggacactgcg
gctcagatcacccagcgcaagtgggaggcatgcggtgaggcggaggagtggagcgtctac
ctggagggcgagtgcctggagtggctccgcagatacttggagaaagggaaggagacgcta
cagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccaaactgaagacacccagcttgtggagaccaggcccgcaggggatgga
accttccagaagtgggcagctgtggtggtgtcttctggagaagagcagggatacacgtgc
catgtgcagcatgaggggctgccggagcctctcaccctgagatgggagccatcttcccag
tccaccatccccatcgtgggcatcgttgctggcctggctgtcctagcctttttggtcacc
ggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggtggaaaaggagggagc
tactctcaggctgcgtgtaagtggtgggggtgggtgtgtggaggagctcacccaccccat
aattcctcctgtcccacgtctcctgcgggctctgaccagatgctgtttttgttctacccc
agc

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677089
Entry
104677089         CDS       T03989                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0102 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104677089
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104677089
   04145 Phagosome
    104677089
  09143 Cell growth and death
   04218 Cellular senescence
    104677089
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104677089
   04612 Antigen processing and presentation
    104677089
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104677089
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104677089
   05330 Allograft rejection
    104677089
   05332 Graft-versus-host disease
    104677089
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104677089
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104677089
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677089
   05170 Human immunodeficiency virus 1 infection
    104677089
   05168 Herpes simplex virus 1 infection
    104677089
   05163 Human cytomegalovirus infection
    104677089
   05167 Kaposi sarcoma-associated herpesvirus infection
    104677089
   05169 Epstein-Barr virus infection
    104677089
   05165 Human papillomavirus infection
    104677089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104677089
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104677089
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104677089
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104677089
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 104677089
NCBI-ProteinID: XP_030784118
LinkDB
Position
4
AA seq 398 aa
MAPRTLLLLLSGVLALTETWAGSHSMRYFHTAVSRPGRGELRFIAVGYVDDTQFVRFDSD
AASPRMEPRAPWMEQEGPEYWDRETQKAKAHAQVFRVNLRTALRYYNQSEAGSHTFQRMH
GCDLGPDGRLLRGYHQLAYDGKDYIALNGDLSSWTAADMAAQVTQRKWEAAREAEQRRAY
LEGECLESLRRYLENGKETLQRSGPPETHVTHHPVSDHEATLRCWVLGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHQGLLEPLTLRWEPSSQ
PTIPNVGIVAGLAVLGAVVTIAVFAAMMWRTKNSSRERVKGRVWILLSHWGFQVPDRSVP
CLINGKHHPLLGRPSLGLVCRHVLFCVAHVTRKDNVSP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggctccccgaaccctcctcctgctgctctcgggggtcctggccctgaccgagacctgg
gccggctcccactccatgaggtatttccacaccgccgtgtctcggcccggccgcggggag
ctccgcttcatcgcggtgggttatgtggatgacacgcagttcgtgcggttcgacagcgac
gccgcgagtccgaggatggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggaccgggagacgcagaaagccaaggcccacgcacaggttttccgagtgaacctgcgc
accgcgcttcgctactacaaccagagcgaggccgggtctcacacattccagaggatgcat
ggctgcgacctggggcctgacgggcgcctcctccgcgggtatcaccagttagcctatgat
ggcaaggattacatcgccctgaacggggacctgagctcctggaccgccgcggatatggcg
gctcaggtcacacagcgcaagtgggaggcggcccgtgaagctgagcagcggagagcctac
ctggagggcgagtgcctggagtccctccgcagatacctggagaatgggaaggagacgctg
cagcgctcgggccccccagagacacacgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggtcctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggagcaaactcaggacactgagcttgtggagaccaggccagcaggggacgga
accttccagaagtgggcggctgtggtggtgccttctggagaagagcagagatacacgtgc
catgtgcagcaccaggggctgctggagcctctcaccctgagatgggagccatcttcccag
cccaccatccccaacgtgggcatcgttgctggcctggctgtcctaggagctgtggtcacc
atagctgtgtttgctgctatgatgtggaggacgaagaactcaagtagggaacgggtgaag
ggtagggtctggattttattgtcccattgggggtttcaagtcccagatagaagtgttccc
tgcctcattaatgggaagcaccatccactcctgggccgtcccagcctgggccttgtgtgc
cggcacgtactcttttgtgtagcacatgtgacaaggaaggacaatgtatcaccttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678084
Entry
104678084         CDS       T03989                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-38 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104678084
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104678084
   04145 Phagosome
    104678084
  09143 Cell growth and death
   04218 Cellular senescence
    104678084
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104678084
   04612 Antigen processing and presentation
    104678084
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104678084
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104678084
   05330 Allograft rejection
    104678084
   05332 Graft-versus-host disease
    104678084
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104678084
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104678084
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104678084
   05170 Human immunodeficiency virus 1 infection
    104678084
   05168 Herpes simplex virus 1 infection
    104678084
   05163 Human cytomegalovirus infection
    104678084
   05167 Kaposi sarcoma-associated herpesvirus infection
    104678084
   05169 Epstein-Barr virus infection
    104678084
   05165 Human papillomavirus infection
    104678084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104678084
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104678084
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104678084
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104678084
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 104678084
NCBI-ProteinID: XP_030783949
LinkDB
Position
4
AA seq 433 aa
MPISVATVPVLKSPLTHQDSDSPQTPRMAVMAPRTLLLVLSGALALTQTRAGSHSMRYFY
TAVSRPGRAEPYFFAVGYVDDTQFVRFDSDAESPRMEPRAPWVEQEGPEYWDQETQNMKT
ATQTYRGNLRTLLRYYNQSQGGSHTIQEMYGCDLGPDGRLLRGYEQFAYDGRDYIALNED
LRSWTAADMAAQNTQRKWEAARAAEQHRTYLEGTCVEWLRRYLENGKETLQRADPPKTYV
THHPVSDHEATLRCWALGYYPAGITLTWQRDGEEQTEDTELVETRPTGDGTFQKWAAVVV
PSGEEQRYTCHVQHEGLPKPLTLRWEPFFQSTIPIVGIIAGLVLLGTVVTGAVVAAVMCR
RKSSDKAGATLRLQAVTVPKVLMCLSRLVKCETAALCGIERQDLFTPSLCDLKNPDFLSA
KAPECVCVPAGIM
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccaatcagcgtcgccacagtcccggttctaaagtccccactcacccaccaggactca
gattctccgcagacgccgaggatggcggtcatggcgccccgaaccctcctcctggtgctc
tcaggggccctggccctgacccagacccgggcgggctctcactccatgaggtatttctac
accgccgtgtcccggcccggccgcgcggagccctacttcttcgccgtgggctacgtggac
gacacgcagttcgtgcggttcgacagcgacgccgagagtccgaggatggagccgcgggcg
ccatgggtggagcaggagggtccagagtattgggaccaggagacacagaacatgaagacc
gcgacacagacctaccgagggaacctgcggaccctgctccgctactacaaccagagccag
ggcgggtctcacaccatccaggagatgtacggctgcgacctggggcccgacgggcgcctc
ctccgcgggtatgaacagttcgcctacgacggcagggattacatcgccctgaacgaggac
ctgcgctcctggacggccgcggacatggcggctcagaacacccagcggaagtgggaggcg
gcccgtgcggcggagcagcacagaacctacctggaggggacgtgcgtggagtggctccgc
agatacctggagaacgggaaggagacgctgcagcgcgcggacccccccaagacatatgtg
acccaccaccccgtctctgaccatgaggccaccctgaggtgctgggccctgggctactac
cctgcggggatcacactgacctggcagcgggatggagaggaacaaactgaggacacagag
ctcgtggagaccaggcctacaggggatggaaccttccagaagtgggcggctgtggtggtg
ccttctggagaggagcagagatacacctgtcatgtgcagcatgagggtctgcccaagccc
ctcaccttgagatgggagccgtttttccagtccaccatccccatcgtaggcatcattgct
ggcctggttctgcttggaactgtggtcactggagctgtggttgctgctgtgatgtgcagg
aggaagagctcagataaggcgggagcgactctcaggctgcaagcagtgacagtgcccaag
gttctgatgtgtctctcacggcttgtaaagtgtgagacagctgccttgtgtgggattgag
aggcaagatttgttcacgccttctctttgtgacttgaagaaccctgactttctttctgca
aaggcacctgaatgtgtctgcgttcctgcaggcataatgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678248
Entry
104678248         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-67 alpha chain
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    104678248
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104678248
   04145 Phagosome
    104678248
  09143 Cell growth and death
   04218 Cellular senescence
    104678248
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    104678248
   04612 Antigen processing and presentation
    104678248
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104678248
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104678248
   05330 Allograft rejection
    104678248
   05332 Graft-versus-host disease
    104678248
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104678248
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    104678248
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104678248
   05170 Human immunodeficiency virus 1 infection
    104678248
   05168 Herpes simplex virus 1 infection
    104678248
   05163 Human cytomegalovirus infection
    104678248
   05167 Kaposi sarcoma-associated herpesvirus infection
    104678248
   05169 Epstein-Barr virus infection
    104678248
   05165 Human papillomavirus infection
    104678248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104678248
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    104678248
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104678248
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  104678248
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 MHC_I_3 ig MATalpha_HMGbox
Other DBs
NCBI-GeneID: 104678248
NCBI-ProteinID: XP_030782436
LinkDB
Position
Unknown
AA seq 403 aa
MAPRTLLLLLSGALTLTETWAGSHSLRYFHTAVSRPGRGEPHFIAVGYVDDTQFLRFDSD
AESPREEPRAPWMKQEGPEYWEEQTRNAEAHAQTHRVSLRNLRGYYNQSEAGSHTLQKLY
GCDLGPDGPLLRGYDQYAYDGRDYIALNEDLRSWTAADMAAQNTQRKWEAARAAEQLRAY
LEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHKTILRCWALGFYPAEITLTWQR
DGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQ
STIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSDSAQGSDVSHGLK
SLRQLSCVGLRCRISSLLXFCDFRRLWHLFLQRHLNVSASLLA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccctcctcctactgctctcgggggccctgaccctgaccgagacctgg
gccggctcgcactccttgaggtatttccacaccgccgtgtcccggcccggccgcggggag
ccccacttcatcgccgtgggctacgtggacgacacgcagttcctgcggttcgacagcgac
gccgagagtccgagagaggagccgcgggcgccgtggatgaagcaggaggggccggagtat
tgggaagagcagacacggaacgccgaggcccacgcacagactcaccgagtgagcctgcgg
aacctgcgcggctactacaaccagagcgaggcggggtctcacaccctccagaagttgtac
ggctgcgacttggggcccgacgggcccctcctccgcgggtatgaccagtacgcctacgac
ggcagggattacatcgccctgaacgaggacctgcgctcctggaccgccgcggacatggcg
gctcagaacacccagcgcaagtgggaggcggcccgtgcggcggagcagctgagagcctac
ctggaggggacgtgcgtggagtggctccgcagatacctggagaacgggaaggagacactg
cagcgcgcggaccccccaaagacacacgtgacccaccaccccgtttctgaccataagacc
atcctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccaaactcaggacaccgagcttgtggagaccaggccaggaggagatgga
accttccagaagtggggagctgtggtggtgccttctggagaagagcagagatacacgtgc
catgtgcagcatgaggggctgccggagcccctcaccctgagatgggagccatcttcccag
tccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagttgtggtcacc
ggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggtggaaaaggagggagc
tactctcaggctgcgtccagtgacagtgcccagggctctgatgtctctcacggcttgaaa
agcctgagacaactgtcttgtgtgggactgagatgcaggatttcttcacttctcnccttt
tgtgacttcaggagactctggcatctctttctgcaaaggcatctgaatgtgtctgcgtcc
ctgttagcataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115897009
Entry
115897009         CDS       T03989                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04144  Endocytosis
rro04145  Phagosome
rro04218  Cellular senescence
rro04514  Cell adhesion molecules
rro04612  Antigen processing and presentation
rro04940  Type I diabetes mellitus
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05203  Viral carcinogenesis
rro05320  Autoimmune thyroid disease
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    115897009
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    115897009
   04145 Phagosome
    115897009
  09143 Cell growth and death
   04218 Cellular senescence
    115897009
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    115897009
   04612 Antigen processing and presentation
    115897009
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    115897009
  09163 Immune disease
   05320 Autoimmune thyroid disease
    115897009
   05330 Allograft rejection
    115897009
   05332 Graft-versus-host disease
    115897009
  09166 Cardiovascular disease
   05416 Viral myocarditis
    115897009
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    115897009
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    115897009
   05170 Human immunodeficiency virus 1 infection
    115897009
   05168 Herpes simplex virus 1 infection
    115897009
   05163 Human cytomegalovirus infection
    115897009
   05167 Kaposi sarcoma-associated herpesvirus infection
    115897009
   05169 Epstein-Barr virus infection
    115897009
   05165 Human papillomavirus infection
    115897009
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    115897009
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
    115897009
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   115897009
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rro00537]
 Antigens
  115897009
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 115897009
NCBI-ProteinID: XP_030785406
LinkDB
Position
4
AA seq 366 aa
MRVMAPQTLLLLLSGALALTDTWAGSHSLRYFSAGTSRSGRGEPRFISVCYVEDTQFVRF
DSDAASPRMEPRAPWVEQEGPEYWEEQTGLAKDFAQTFRVSLRNLRGYYNQSEAGSHTLQ
RMSGCDLGPDRHLLRGYHQIAYDGKDYIALNGDLRSWTAADTAADTAAQITQHKWEAARE
AEQWRAHLEGTCVEWQRRHLENGKETLQRADPPKTHMTHHPVSDHEATLRCWVLGFYPAE
ITLTWQGDGEDQTQDTELVKTRPAGDGTYQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTL
RWEPSSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSDSAQGS
AVSLTA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccaaaccctcctcctgctgctctcgggggccctggccctgacc
gacacctgggccggctcgcactccttgaggtatttcagcgccggcacgtcccggtctggc
cgcggggagccccgcttcatctccgtgtgttacgtggaggacacgcagttcgtgcggttc
gacagcgacgccgcgagtccaaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaggagcagacagggctcgccaaggactttgcacagactttccgagtg
agcctgaggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
aggatgtctggctgcgatctggggcccgaccggcacctcctccgcgggtatcaccagatc
gcctacgatggcaaggattacatcgccctgaacggggacctgcgctcctggaccgcggca
gacacggcggcagacacggcggctcagatcacccagcacaagtgggaggcggcccgcgag
gcagagcagtggagagcccacctggaggggacgtgcgtggagtggcagcgcagacacctg
gagaacgggaaggagacactgcagcgcgcagatcccccaaagacacacatgacccaccac
cccgtctctgaccatgaggccaccctgaggtgctgggtcctgggcttctatcctgcggag
atcacactgacctggcagggggatggggaggaccaaactcaggacaccgagcttgtgaag
accaggccagcaggagatggaacttaccagaagtggggagctgtggtggtgccttctgga
gaagagcagagatacacgtgccatgtgcagcatgaggggctgccggaacccctcaccctg
agatgggagccatcttcccagtccaccatccccatcgtggggattgttgctggcctggct
gtcctagcagttgtggtcaccggagctgtggtcgctgctgtgatgtggaggaggaagagc
tcaggtggaaaaggagggagctactctcaggctgcgtccagcgacagtgcccagggctct
gctgtgtctctcacggcttga

DBGET integrated database retrieval system