KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661961Help
Entry
104661961         CDS       T03989                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00010  Glycolysis / Gluconeogenesis
rro00051  Fructose and mannose metabolism
rro00052  Galactose metabolism
rro00500  Starch and sucrose metabolism
rro00520  Amino sugar and nucleotide sugar metabolism
rro00524  Neomycin, kanamycin and gentamicin biosynthesis
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro04066  HIF-1 signaling pathway
rro04910  Insulin signaling pathway
rro04930  Type II diabetes mellitus
rro04973  Carbohydrate digestion and absorption
rro05230  Central carbon metabolism in cancer
Module
rro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104661961 (HKDC1)
   00051 Fructose and mannose metabolism
    104661961 (HKDC1)
   00052 Galactose metabolism
    104661961 (HKDC1)
   00500 Starch and sucrose metabolism
    104661961 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    104661961 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104661961 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    104661961 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104661961 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104661961 (HKDC1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    104661961 (HKDC1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    104661961 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104661961 (HKDC1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104661961 (HKDC1)
Membrane trafficking [BR:rro04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104661961 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104661961
NCBI-ProteinID: XP_010361120
UniProt: A0A2K6Q4H2
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQMFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETWHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFRLT
QEQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGVSLPLGFT
FSFPCRQTSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGDEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRTILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKDN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgacacccttttggacatcatg
aggcggttccgggccgagatggagaagggcttggcgaaggacaccaaccccacggccgcg
gtgaagatgctgcccaccttcgtcagggccattcctgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagtttcgagtgctgaaggtgcaagtcgctgaagaa
gggaagcgacacgtgcagatggagagtcagttctacccaacgcccaatgaaatcatccgt
gggaacggcacagagctgtttgaatatgtagcagactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgccgacag
actaaactggaagagggtgtcctgctttcatggacaaagaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgaggagacacaaggacatggac
gtggacatcctggccctggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaactggcacaaatgcgtgttatatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggcctttggggacgacggggccctggaggacattcgcaccgagttcgacagggag
ctggacctcggctctctcaacccgggaaagcaaatgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaagggcaagattgaaacatggcacgtggct
gccatggagaagtataaagaaggccttgccaatacaagagagatcctggtggacctgggc
ctggagccatctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcggccaacctctgcgcagcagccctggcggccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcgtggacggcaccctctacaagatacac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccgagctgtgatgtc
cgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcagtggcc
tcccgcgtgcaggcccagcggaagcagatcgacaaggtgctggctttgttccggctgacc
caagagcagctcgtggacgtgcaggccaagatgcgggctgagctggagtacgggctgaag
aagaagagccacgggctggccacggtcagaatgctgcccacctacgtctgcgggctgccg
gacggcacagagaaaggaaagtttctcgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggagatcatgcagggcactggtgaggagctctttgaccacattgtgcagtgc
atcgccgacttcctggactacatgggcctcaagggagtctccctacctttgggcttcacg
ttctcatttccctgcaggcagacaagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagagaagaaacgagtttgacctggacatcgttgcagttgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcttgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggagggggatgaaggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggacgaggggtccttgaatcctggcaagcagagatat
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtcttctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagattgaaagcgatcggctggccctcctccaggtcagg
acgattctgcagcagctgggcctggacagcacatgtgaggacagcatcgtggtgaaggag
gtgtgcggagctgtgtcccggagggcggcccagctctgtggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggac
ggcaccctgtacaagcttcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacagaaggataactag

DBGET integrated database retrieval system