KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662124
Entry
104662124         CDS       T03989                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104662124 (PIK3R3)
   04014 Ras signaling pathway
    104662124 (PIK3R3)
   04015 Rap1 signaling pathway
    104662124 (PIK3R3)
   04370 VEGF signaling pathway
    104662124 (PIK3R3)
   04630 JAK-STAT signaling pathway
    104662124 (PIK3R3)
   04668 TNF signaling pathway
    104662124 (PIK3R3)
   04066 HIF-1 signaling pathway
    104662124 (PIK3R3)
   04068 FoxO signaling pathway
    104662124 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    104662124 (PIK3R3)
   04072 Phospholipase D signaling pathway
    104662124 (PIK3R3)
   04071 Sphingolipid signaling pathway
    104662124 (PIK3R3)
   04024 cAMP signaling pathway
    104662124 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    104662124 (PIK3R3)
   04152 AMPK signaling pathway
    104662124 (PIK3R3)
   04150 mTOR signaling pathway
    104662124 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104662124 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    104662124 (PIK3R3)
   04218 Cellular senescence
    104662124 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104662124 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    104662124 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104662124 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104662124 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    104662124 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    104662124 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    104662124 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    104662124 (PIK3R3)
   04660 T cell receptor signaling pathway
    104662124 (PIK3R3)
   04662 B cell receptor signaling pathway
    104662124 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    104662124 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    104662124 (PIK3R3)
   04670 Leukocyte transendothelial migration
    104662124 (PIK3R3)
   04062 Chemokine signaling pathway
    104662124 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104662124 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    104662124 (PIK3R3)
   04929 GnRH secretion
    104662124 (PIK3R3)
   04915 Estrogen signaling pathway
    104662124 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    104662124 (PIK3R3)
   04917 Prolactin signaling pathway
    104662124 (PIK3R3)
   04926 Relaxin signaling pathway
    104662124 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    104662124 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    104662124 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104662124 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104662124 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    104662124 (PIK3R3)
   04722 Neurotrophin signaling pathway
    104662124 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104662124 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    104662124 (PIK3R3)
   04380 Osteoclast differentiation
    104662124 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    104662124 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    104662124 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662124 (PIK3R3)
   05206 MicroRNAs in cancer
    104662124 (PIK3R3)
   05205 Proteoglycans in cancer
    104662124 (PIK3R3)
   05203 Viral carcinogenesis
    104662124 (PIK3R3)
   05230 Central carbon metabolism in cancer
    104662124 (PIK3R3)
   05231 Choline metabolism in cancer
    104662124 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104662124 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104662124 (PIK3R3)
   05212 Pancreatic cancer
    104662124 (PIK3R3)
   05225 Hepatocellular carcinoma
    104662124 (PIK3R3)
   05226 Gastric cancer
    104662124 (PIK3R3)
   05214 Glioma
    104662124 (PIK3R3)
   05221 Acute myeloid leukemia
    104662124 (PIK3R3)
   05220 Chronic myeloid leukemia
    104662124 (PIK3R3)
   05218 Melanoma
    104662124 (PIK3R3)
   05211 Renal cell carcinoma
    104662124 (PIK3R3)
   05215 Prostate cancer
    104662124 (PIK3R3)
   05213 Endometrial cancer
    104662124 (PIK3R3)
   05224 Breast cancer
    104662124 (PIK3R3)
   05222 Small cell lung cancer
    104662124 (PIK3R3)
   05223 Non-small cell lung cancer
    104662124 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104662124 (PIK3R3)
   05017 Spinocerebellar ataxia
    104662124 (PIK3R3)
   05020 Prion disease
    104662124 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104662124 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104662124 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    104662124 (PIK3R3)
   04931 Insulin resistance
    104662124 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104662124 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104662124 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    104662124 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662124 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    104662124 (PIK3R3)
   05161 Hepatitis B
    104662124 (PIK3R3)
   05160 Hepatitis C
    104662124 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    104662124 (PIK3R3)
   05164 Influenza A
    104662124 (PIK3R3)
   05162 Measles
    104662124 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    104662124 (PIK3R3)
   05163 Human cytomegalovirus infection
    104662124 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662124 (PIK3R3)
   05169 Epstein-Barr virus infection
    104662124 (PIK3R3)
   05165 Human papillomavirus infection
    104662124 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104662124 (PIK3R3)
   05142 Chagas disease
    104662124 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104662124 (PIK3R3)
   01524 Platinum drug resistance
    104662124 (PIK3R3)
   01522 Endocrine resistance
    104662124 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104662124 (PIK3R3)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104662124 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 104662124
NCBI-ProteinID: XP_010361340
UniProt: A0A2K6QPZ6
LinkDB
Position
12
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacagtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccagatgggaccttcttggtccgagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagttaataaagatctatcaccgggatggt
aaatatggcttttctgatcctctgacatttaattccgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaagcttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaagagaagagtaaagagtatgataggctctatgaa
gaatatacaagaacatcccaggaaatacagatgaagaggactgcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagagtat
attgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggagagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataagaaaatgaatagtatcaaacct
gacctgatccagctgcgaaagatccgagatcaacaccttgtatggctcaatcacaaaggg
gtgagacagaaacgcctgaatgcctggctgggaattaagaatgaggatgctgatgagaac
tattttatcaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgctctgtggtggctgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctctctgaaggagctagtgctccattaccagcagacatccttggttcagcac
aacgactccctcaatgtcaggcttgcctaccctgttcatgcacagatgccctcgctgtgc
agataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663050
Entry
104663050         CDS       T03989                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104663050 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104663050 (PIK3CD)
   04014 Ras signaling pathway
    104663050 (PIK3CD)
   04015 Rap1 signaling pathway
    104663050 (PIK3CD)
   04370 VEGF signaling pathway
    104663050 (PIK3CD)
   04630 JAK-STAT signaling pathway
    104663050 (PIK3CD)
   04668 TNF signaling pathway
    104663050 (PIK3CD)
   04066 HIF-1 signaling pathway
    104663050 (PIK3CD)
   04068 FoxO signaling pathway
    104663050 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    104663050 (PIK3CD)
   04072 Phospholipase D signaling pathway
    104663050 (PIK3CD)
   04071 Sphingolipid signaling pathway
    104663050 (PIK3CD)
   04024 cAMP signaling pathway
    104663050 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    104663050 (PIK3CD)
   04152 AMPK signaling pathway
    104663050 (PIK3CD)
   04150 mTOR signaling pathway
    104663050 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104663050 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    104663050 (PIK3CD)
   04218 Cellular senescence
    104663050 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104663050 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    104663050 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104663050 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104663050 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    104663050 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    104663050 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    104663050 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    104663050 (PIK3CD)
   04660 T cell receptor signaling pathway
    104663050 (PIK3CD)
   04662 B cell receptor signaling pathway
    104663050 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    104663050 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    104663050 (PIK3CD)
   04670 Leukocyte transendothelial migration
    104663050 (PIK3CD)
   04062 Chemokine signaling pathway
    104663050 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104663050 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    104663050 (PIK3CD)
   04929 GnRH secretion
    104663050 (PIK3CD)
   04915 Estrogen signaling pathway
    104663050 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    104663050 (PIK3CD)
   04917 Prolactin signaling pathway
    104663050 (PIK3CD)
   04926 Relaxin signaling pathway
    104663050 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    104663050 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    104663050 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104663050 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104663050 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    104663050 (PIK3CD)
   04722 Neurotrophin signaling pathway
    104663050 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104663050 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    104663050 (PIK3CD)
   04380 Osteoclast differentiation
    104663050 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    104663050 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    104663050 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663050 (PIK3CD)
   05206 MicroRNAs in cancer
    104663050 (PIK3CD)
   05205 Proteoglycans in cancer
    104663050 (PIK3CD)
   05203 Viral carcinogenesis
    104663050 (PIK3CD)
   05230 Central carbon metabolism in cancer
    104663050 (PIK3CD)
   05231 Choline metabolism in cancer
    104663050 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104663050 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104663050 (PIK3CD)
   05212 Pancreatic cancer
    104663050 (PIK3CD)
   05225 Hepatocellular carcinoma
    104663050 (PIK3CD)
   05226 Gastric cancer
    104663050 (PIK3CD)
   05214 Glioma
    104663050 (PIK3CD)
   05221 Acute myeloid leukemia
    104663050 (PIK3CD)
   05220 Chronic myeloid leukemia
    104663050 (PIK3CD)
   05218 Melanoma
    104663050 (PIK3CD)
   05211 Renal cell carcinoma
    104663050 (PIK3CD)
   05215 Prostate cancer
    104663050 (PIK3CD)
   05213 Endometrial cancer
    104663050 (PIK3CD)
   05224 Breast cancer
    104663050 (PIK3CD)
   05222 Small cell lung cancer
    104663050 (PIK3CD)
   05223 Non-small cell lung cancer
    104663050 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104663050 (PIK3CD)
   05017 Spinocerebellar ataxia
    104663050 (PIK3CD)
   05020 Prion disease
    104663050 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104663050 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104663050 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    104663050 (PIK3CD)
   04931 Insulin resistance
    104663050 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104663050 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104663050 (PIK3CD)
   05135 Yersinia infection
    104663050 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    104663050 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104663050 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    104663050 (PIK3CD)
   05161 Hepatitis B
    104663050 (PIK3CD)
   05160 Hepatitis C
    104663050 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    104663050 (PIK3CD)
   05164 Influenza A
    104663050 (PIK3CD)
   05162 Measles
    104663050 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    104663050 (PIK3CD)
   05163 Human cytomegalovirus infection
    104663050 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104663050 (PIK3CD)
   05169 Epstein-Barr virus infection
    104663050 (PIK3CD)
   05165 Human papillomavirus infection
    104663050 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104663050 (PIK3CD)
   05142 Chagas disease
    104663050 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104663050 (PIK3CD)
   01524 Platinum drug resistance
    104663050 (PIK3CD)
   01522 Endocrine resistance
    104663050 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104663050 (PIK3CD)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104663050 (PIK3CD)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104663050 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 104663050
NCBI-ProteinID: XP_010362482
UniProt: A0A2K6P7P0
LinkDB
Position
12
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRRQLSWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
TEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKCKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVHSNPNTDSAAALLICLPEVAP
HPVYYPTLEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctatggcaccgcgcccagtatgagccactcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacggcggagcagcag
gagctggaggatgagcaacggcgtctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggtgaccgcgtgaagaagctcatcaactcgcagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgtgacccagaagtgaacgactttcgt
gccaagatgtgccagttctgcgaggaggcggctgcccgccggcggcagctgagctgggag
gcctggttgcagtacagcttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccaaaccgggccctcctagtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacagtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgctcctcaggtccagaaaccacgt
gccaaaccgcctcccattcctgcaaagaagccctcctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggcagggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
acagaggtgagtgtgtgctcggaacctgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgcttcgcactgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtgcaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagactggggaacgctgtctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacaggcactgtgcat
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcctgaggtggccccg
caccccgtgtactatcccaccctggagaagatcttggagctggggcggcacagtgagtgt
gtacatgtcaccgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctctatgagcatgagaaggacctggtgtggaagctgcggcacgaagtccaggag
cacttcccagaggcactagcccggctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggaactgcctgtcctgagcgccctg
gagctgctggacttcagcttccctgattgccatgtaggctccttcgccatcaagtcgctg
cggaaactgacggatgatgagctgttccagtacttgctgcagctggtgcaggtgctaaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcagtg
gccctgcgcttcggcctcatcttggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggcactgaacgacttcgtcaag
ctgagctctcagaagacccccaagccccagacgaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagcggtggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgctcagacaccattgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggatgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagtgacaacatcatg
atccgagagagtgggcagttgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaat
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaag
gacaacaggcagtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665061
Entry
104665061         CDS       T03989                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104665061 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104665061 (PIK3CB)
   04014 Ras signaling pathway
    104665061 (PIK3CB)
   04015 Rap1 signaling pathway
    104665061 (PIK3CB)
   04370 VEGF signaling pathway
    104665061 (PIK3CB)
   04630 JAK-STAT signaling pathway
    104665061 (PIK3CB)
   04668 TNF signaling pathway
    104665061 (PIK3CB)
   04066 HIF-1 signaling pathway
    104665061 (PIK3CB)
   04068 FoxO signaling pathway
    104665061 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    104665061 (PIK3CB)
   04072 Phospholipase D signaling pathway
    104665061 (PIK3CB)
   04071 Sphingolipid signaling pathway
    104665061 (PIK3CB)
   04024 cAMP signaling pathway
    104665061 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    104665061 (PIK3CB)
   04152 AMPK signaling pathway
    104665061 (PIK3CB)
   04150 mTOR signaling pathway
    104665061 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104665061 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    104665061 (PIK3CB)
   04218 Cellular senescence
    104665061 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104665061 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    104665061 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104665061 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104665061 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    104665061 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    104665061 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    104665061 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    104665061 (PIK3CB)
   04660 T cell receptor signaling pathway
    104665061 (PIK3CB)
   04662 B cell receptor signaling pathway
    104665061 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    104665061 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    104665061 (PIK3CB)
   04670 Leukocyte transendothelial migration
    104665061 (PIK3CB)
   04062 Chemokine signaling pathway
    104665061 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104665061 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    104665061 (PIK3CB)
   04929 GnRH secretion
    104665061 (PIK3CB)
   04915 Estrogen signaling pathway
    104665061 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    104665061 (PIK3CB)
   04917 Prolactin signaling pathway
    104665061 (PIK3CB)
   04926 Relaxin signaling pathway
    104665061 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    104665061 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    104665061 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104665061 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104665061 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    104665061 (PIK3CB)
   04722 Neurotrophin signaling pathway
    104665061 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104665061 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    104665061 (PIK3CB)
   04380 Osteoclast differentiation
    104665061 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    104665061 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    104665061 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665061 (PIK3CB)
   05206 MicroRNAs in cancer
    104665061 (PIK3CB)
   05205 Proteoglycans in cancer
    104665061 (PIK3CB)
   05203 Viral carcinogenesis
    104665061 (PIK3CB)
   05230 Central carbon metabolism in cancer
    104665061 (PIK3CB)
   05231 Choline metabolism in cancer
    104665061 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104665061 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104665061 (PIK3CB)
   05212 Pancreatic cancer
    104665061 (PIK3CB)
   05225 Hepatocellular carcinoma
    104665061 (PIK3CB)
   05226 Gastric cancer
    104665061 (PIK3CB)
   05214 Glioma
    104665061 (PIK3CB)
   05221 Acute myeloid leukemia
    104665061 (PIK3CB)
   05220 Chronic myeloid leukemia
    104665061 (PIK3CB)
   05218 Melanoma
    104665061 (PIK3CB)
   05211 Renal cell carcinoma
    104665061 (PIK3CB)
   05215 Prostate cancer
    104665061 (PIK3CB)
   05213 Endometrial cancer
    104665061 (PIK3CB)
   05224 Breast cancer
    104665061 (PIK3CB)
   05222 Small cell lung cancer
    104665061 (PIK3CB)
   05223 Non-small cell lung cancer
    104665061 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104665061 (PIK3CB)
   05017 Spinocerebellar ataxia
    104665061 (PIK3CB)
   05020 Prion disease
    104665061 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104665061 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104665061 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    104665061 (PIK3CB)
   04931 Insulin resistance
    104665061 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104665061 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104665061 (PIK3CB)
   05135 Yersinia infection
    104665061 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    104665061 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104665061 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    104665061 (PIK3CB)
   05161 Hepatitis B
    104665061 (PIK3CB)
   05160 Hepatitis C
    104665061 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    104665061 (PIK3CB)
   05164 Influenza A
    104665061 (PIK3CB)
   05162 Measles
    104665061 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    104665061 (PIK3CB)
   05163 Human cytomegalovirus infection
    104665061 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104665061 (PIK3CB)
   05169 Epstein-Barr virus infection
    104665061 (PIK3CB)
   05165 Human papillomavirus infection
    104665061 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104665061 (PIK3CB)
   05142 Chagas disease
    104665061 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104665061 (PIK3CB)
   01524 Platinum drug resistance
    104665061 (PIK3CB)
   01522 Endocrine resistance
    104665061 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104665061 (PIK3CB)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104665061 (PIK3CB)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104665061 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 104665061
NCBI-ProteinID: XP_010365050
UniProt: A0A2K6RRD5
LinkDB
Position
1
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAIHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAIYAVLDKVKTKKSTKNI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIMLHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaaccagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgattccttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagcgaggaaaagatc
ttgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccggagcat
gaaccatccatccctgaaaacttagaagataaactttatgggggaaagctcattgtagct
attcattttgaaaactgccaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaagtaaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gttagcccctatgattatgtgttgcaagtcagtgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccgaaactgtgtaatgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatcggaattcatctaaccttcctcttccattaccaccaaagaaaacg
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaaccatcgtaagctcagaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctatttatgctgttttggataaagtaaaaacgaagaaatcaacgaaaaatatt
aatccctctaaatatcagaccatcagaaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatgttacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatattaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagattttcccacaatcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcgctgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtacgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcagtatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttggtaatcggaggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagttaaacagagccaaagggaaggag
gccatgcatacctgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cccctgaacccatgtgttatcctctcggaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccagatgttg
cgcttgatggatttactctggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttacactgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcgctgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670605
Entry
104670605         CDS       T03989                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104670605 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104670605 (PIK3CA)
   04014 Ras signaling pathway
    104670605 (PIK3CA)
   04015 Rap1 signaling pathway
    104670605 (PIK3CA)
   04370 VEGF signaling pathway
    104670605 (PIK3CA)
   04630 JAK-STAT signaling pathway
    104670605 (PIK3CA)
   04668 TNF signaling pathway
    104670605 (PIK3CA)
   04066 HIF-1 signaling pathway
    104670605 (PIK3CA)
   04068 FoxO signaling pathway
    104670605 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    104670605 (PIK3CA)
   04072 Phospholipase D signaling pathway
    104670605 (PIK3CA)
   04071 Sphingolipid signaling pathway
    104670605 (PIK3CA)
   04024 cAMP signaling pathway
    104670605 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    104670605 (PIK3CA)
   04152 AMPK signaling pathway
    104670605 (PIK3CA)
   04150 mTOR signaling pathway
    104670605 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104670605 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    104670605 (PIK3CA)
   04218 Cellular senescence
    104670605 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670605 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    104670605 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670605 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104670605 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    104670605 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    104670605 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    104670605 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    104670605 (PIK3CA)
   04660 T cell receptor signaling pathway
    104670605 (PIK3CA)
   04662 B cell receptor signaling pathway
    104670605 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    104670605 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    104670605 (PIK3CA)
   04670 Leukocyte transendothelial migration
    104670605 (PIK3CA)
   04062 Chemokine signaling pathway
    104670605 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104670605 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    104670605 (PIK3CA)
   04929 GnRH secretion
    104670605 (PIK3CA)
   04915 Estrogen signaling pathway
    104670605 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    104670605 (PIK3CA)
   04917 Prolactin signaling pathway
    104670605 (PIK3CA)
   04926 Relaxin signaling pathway
    104670605 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    104670605 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    104670605 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104670605 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104670605 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    104670605 (PIK3CA)
   04722 Neurotrophin signaling pathway
    104670605 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104670605 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    104670605 (PIK3CA)
   04380 Osteoclast differentiation
    104670605 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    104670605 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    104670605 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670605 (PIK3CA)
   05206 MicroRNAs in cancer
    104670605 (PIK3CA)
   05205 Proteoglycans in cancer
    104670605 (PIK3CA)
   05203 Viral carcinogenesis
    104670605 (PIK3CA)
   05230 Central carbon metabolism in cancer
    104670605 (PIK3CA)
   05231 Choline metabolism in cancer
    104670605 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104670605 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104670605 (PIK3CA)
   05212 Pancreatic cancer
    104670605 (PIK3CA)
   05225 Hepatocellular carcinoma
    104670605 (PIK3CA)
   05226 Gastric cancer
    104670605 (PIK3CA)
   05214 Glioma
    104670605 (PIK3CA)
   05221 Acute myeloid leukemia
    104670605 (PIK3CA)
   05220 Chronic myeloid leukemia
    104670605 (PIK3CA)
   05218 Melanoma
    104670605 (PIK3CA)
   05211 Renal cell carcinoma
    104670605 (PIK3CA)
   05215 Prostate cancer
    104670605 (PIK3CA)
   05213 Endometrial cancer
    104670605 (PIK3CA)
   05224 Breast cancer
    104670605 (PIK3CA)
   05222 Small cell lung cancer
    104670605 (PIK3CA)
   05223 Non-small cell lung cancer
    104670605 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104670605 (PIK3CA)
   05017 Spinocerebellar ataxia
    104670605 (PIK3CA)
   05020 Prion disease
    104670605 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104670605 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104670605 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    104670605 (PIK3CA)
   04931 Insulin resistance
    104670605 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104670605 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104670605 (PIK3CA)
   05135 Yersinia infection
    104670605 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    104670605 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104670605 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    104670605 (PIK3CA)
   05161 Hepatitis B
    104670605 (PIK3CA)
   05160 Hepatitis C
    104670605 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    104670605 (PIK3CA)
   05164 Influenza A
    104670605 (PIK3CA)
   05162 Measles
    104670605 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    104670605 (PIK3CA)
   05163 Human cytomegalovirus infection
    104670605 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670605 (PIK3CA)
   05169 Epstein-Barr virus infection
    104670605 (PIK3CA)
   05165 Human papillomavirus infection
    104670605 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104670605 (PIK3CA)
   05142 Chagas disease
    104670605 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104670605 (PIK3CA)
   01524 Platinum drug resistance
    104670605 (PIK3CA)
   01522 Endocrine resistance
    104670605 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104670605 (PIK3CA)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104670605 (PIK3CA)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104670605 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 104670605
NCBI-ProteinID: XP_010372245
UniProt: A0A2K6P5T5
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVSQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcgccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgccgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacagctaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgaccttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
tcccagatgtattgcttggtaaaagactggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaaaaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacactctacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtcgctaccttcattctgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675620
Entry
104675620         CDS       T03989                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104675620 (PIK3R1)
   04014 Ras signaling pathway
    104675620 (PIK3R1)
   04015 Rap1 signaling pathway
    104675620 (PIK3R1)
   04370 VEGF signaling pathway
    104675620 (PIK3R1)
   04630 JAK-STAT signaling pathway
    104675620 (PIK3R1)
   04668 TNF signaling pathway
    104675620 (PIK3R1)
   04066 HIF-1 signaling pathway
    104675620 (PIK3R1)
   04068 FoxO signaling pathway
    104675620 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    104675620 (PIK3R1)
   04072 Phospholipase D signaling pathway
    104675620 (PIK3R1)
   04071 Sphingolipid signaling pathway
    104675620 (PIK3R1)
   04024 cAMP signaling pathway
    104675620 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    104675620 (PIK3R1)
   04152 AMPK signaling pathway
    104675620 (PIK3R1)
   04150 mTOR signaling pathway
    104675620 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104675620 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    104675620 (PIK3R1)
   04218 Cellular senescence
    104675620 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675620 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104675620 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675620 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104675620 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    104675620 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    104675620 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    104675620 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    104675620 (PIK3R1)
   04660 T cell receptor signaling pathway
    104675620 (PIK3R1)
   04662 B cell receptor signaling pathway
    104675620 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    104675620 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    104675620 (PIK3R1)
   04670 Leukocyte transendothelial migration
    104675620 (PIK3R1)
   04062 Chemokine signaling pathway
    104675620 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104675620 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    104675620 (PIK3R1)
   04929 GnRH secretion
    104675620 (PIK3R1)
   04915 Estrogen signaling pathway
    104675620 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    104675620 (PIK3R1)
   04917 Prolactin signaling pathway
    104675620 (PIK3R1)
   04926 Relaxin signaling pathway
    104675620 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    104675620 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    104675620 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104675620 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104675620 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    104675620 (PIK3R1)
   04722 Neurotrophin signaling pathway
    104675620 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104675620 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    104675620 (PIK3R1)
   04380 Osteoclast differentiation
    104675620 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    104675620 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    104675620 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675620 (PIK3R1)
   05206 MicroRNAs in cancer
    104675620 (PIK3R1)
   05205 Proteoglycans in cancer
    104675620 (PIK3R1)
   05203 Viral carcinogenesis
    104675620 (PIK3R1)
   05230 Central carbon metabolism in cancer
    104675620 (PIK3R1)
   05231 Choline metabolism in cancer
    104675620 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104675620 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104675620 (PIK3R1)
   05212 Pancreatic cancer
    104675620 (PIK3R1)
   05225 Hepatocellular carcinoma
    104675620 (PIK3R1)
   05226 Gastric cancer
    104675620 (PIK3R1)
   05214 Glioma
    104675620 (PIK3R1)
   05221 Acute myeloid leukemia
    104675620 (PIK3R1)
   05220 Chronic myeloid leukemia
    104675620 (PIK3R1)
   05218 Melanoma
    104675620 (PIK3R1)
   05211 Renal cell carcinoma
    104675620 (PIK3R1)
   05215 Prostate cancer
    104675620 (PIK3R1)
   05213 Endometrial cancer
    104675620 (PIK3R1)
   05224 Breast cancer
    104675620 (PIK3R1)
   05222 Small cell lung cancer
    104675620 (PIK3R1)
   05223 Non-small cell lung cancer
    104675620 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104675620 (PIK3R1)
   05017 Spinocerebellar ataxia
    104675620 (PIK3R1)
   05020 Prion disease
    104675620 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104675620 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104675620 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    104675620 (PIK3R1)
   04931 Insulin resistance
    104675620 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104675620 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104675620 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    104675620 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104675620 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    104675620 (PIK3R1)
   05161 Hepatitis B
    104675620 (PIK3R1)
   05160 Hepatitis C
    104675620 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    104675620 (PIK3R1)
   05164 Influenza A
    104675620 (PIK3R1)
   05162 Measles
    104675620 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    104675620 (PIK3R1)
   05163 Human cytomegalovirus infection
    104675620 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675620 (PIK3R1)
   05169 Epstein-Barr virus infection
    104675620 (PIK3R1)
   05165 Human papillomavirus infection
    104675620 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104675620 (PIK3R1)
   05142 Chagas disease
    104675620 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675620 (PIK3R1)
   01524 Platinum drug resistance
    104675620 (PIK3R1)
   01522 Endocrine resistance
    104675620 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104675620 (PIK3R1)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104675620 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C FANCI_S2 PI_PP_I Mod_r Bap31_Bap29_C
Other DBs
NCBI-GeneID: 104675620
NCBI-ProteinID: XP_010378506
UniProt: A0A2K6PY64
LinkDB
Position
3
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTASVDLEMIDVH
ILADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaagaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtaaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacgccaaagccccggccgcctcggcctcttcctgttgcaccaggt
tcttcaaaaactgaagcagatgttgaacaacaagctttgactctcccggaccttgcagag
cagtttgcccctcctgacgttgccccgcctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatacagcctctgtggacttggaaatgatcgatgtgcac
attttggccgacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatatt
cagctattgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcaaacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctct
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcaagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggtacgagatgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaagctg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagt
agagaatatgatagattatatgaagaatatacccgtacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgaaaccatcaaaatatttgaagaacagtgccagacc
caggagcgctacagcaaagaatacatagaaaagtttaaacgtgagggcaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtaggagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacgagagaccaatac
ttgatgtggttgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcgctggtggaagatgatgaagatttaccccatcatgat
gagaagacgtggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcgactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680672
Entry
104680672         CDS       T03989                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04750  Inflammatory mediator regulation of TRP channels
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05020  Prion disease
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05142  Chagas disease
rro05146  Amoebiasis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104680672 (PIK3R2)
   04014 Ras signaling pathway
    104680672 (PIK3R2)
   04015 Rap1 signaling pathway
    104680672 (PIK3R2)
   04370 VEGF signaling pathway
    104680672 (PIK3R2)
   04630 JAK-STAT signaling pathway
    104680672 (PIK3R2)
   04668 TNF signaling pathway
    104680672 (PIK3R2)
   04066 HIF-1 signaling pathway
    104680672 (PIK3R2)
   04068 FoxO signaling pathway
    104680672 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    104680672 (PIK3R2)
   04072 Phospholipase D signaling pathway
    104680672 (PIK3R2)
   04071 Sphingolipid signaling pathway
    104680672 (PIK3R2)
   04024 cAMP signaling pathway
    104680672 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    104680672 (PIK3R2)
   04152 AMPK signaling pathway
    104680672 (PIK3R2)
   04150 mTOR signaling pathway
    104680672 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104680672 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    104680672 (PIK3R2)
   04218 Cellular senescence
    104680672 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104680672 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    104680672 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104680672 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104680672 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    104680672 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    104680672 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    104680672 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    104680672 (PIK3R2)
   04660 T cell receptor signaling pathway
    104680672 (PIK3R2)
   04662 B cell receptor signaling pathway
    104680672 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    104680672 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    104680672 (PIK3R2)
   04670 Leukocyte transendothelial migration
    104680672 (PIK3R2)
   04062 Chemokine signaling pathway
    104680672 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104680672 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    104680672 (PIK3R2)
   04929 GnRH secretion
    104680672 (PIK3R2)
   04915 Estrogen signaling pathway
    104680672 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    104680672 (PIK3R2)
   04917 Prolactin signaling pathway
    104680672 (PIK3R2)
   04926 Relaxin signaling pathway
    104680672 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    104680672 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    104680672 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104680672 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104680672 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    104680672 (PIK3R2)
   04722 Neurotrophin signaling pathway
    104680672 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104680672 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    104680672 (PIK3R2)
   04380 Osteoclast differentiation
    104680672 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    104680672 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    104680672 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680672 (PIK3R2)
   05206 MicroRNAs in cancer
    104680672 (PIK3R2)
   05205 Proteoglycans in cancer
    104680672 (PIK3R2)
   05203 Viral carcinogenesis
    104680672 (PIK3R2)
   05230 Central carbon metabolism in cancer
    104680672 (PIK3R2)
   05231 Choline metabolism in cancer
    104680672 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104680672 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104680672 (PIK3R2)
   05212 Pancreatic cancer
    104680672 (PIK3R2)
   05225 Hepatocellular carcinoma
    104680672 (PIK3R2)
   05226 Gastric cancer
    104680672 (PIK3R2)
   05214 Glioma
    104680672 (PIK3R2)
   05221 Acute myeloid leukemia
    104680672 (PIK3R2)
   05220 Chronic myeloid leukemia
    104680672 (PIK3R2)
   05218 Melanoma
    104680672 (PIK3R2)
   05211 Renal cell carcinoma
    104680672 (PIK3R2)
   05215 Prostate cancer
    104680672 (PIK3R2)
   05213 Endometrial cancer
    104680672 (PIK3R2)
   05224 Breast cancer
    104680672 (PIK3R2)
   05222 Small cell lung cancer
    104680672 (PIK3R2)
   05223 Non-small cell lung cancer
    104680672 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104680672 (PIK3R2)
   05017 Spinocerebellar ataxia
    104680672 (PIK3R2)
   05020 Prion disease
    104680672 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104680672 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104680672 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    104680672 (PIK3R2)
   04931 Insulin resistance
    104680672 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104680672 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104680672 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    104680672 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104680672 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    104680672 (PIK3R2)
   05161 Hepatitis B
    104680672 (PIK3R2)
   05160 Hepatitis C
    104680672 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    104680672 (PIK3R2)
   05164 Influenza A
    104680672 (PIK3R2)
   05162 Measles
    104680672 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    104680672 (PIK3R2)
   05163 Human cytomegalovirus infection
    104680672 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680672 (PIK3R2)
   05169 Epstein-Barr virus infection
    104680672 (PIK3R2)
   05165 Human papillomavirus infection
    104680672 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104680672 (PIK3R2)
   05142 Chagas disease
    104680672 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104680672 (PIK3R2)
   01524 Platinum drug resistance
    104680672 (PIK3R2)
   01522 Endocrine resistance
    104680672 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104680672 (PIK3R2)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104680672 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 104680672
NCBI-ProteinID: XP_030791617
LinkDB
Position
8
AA seq 727 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPTPRTDWTLSDVDQWDVTALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPSSPPPGGAPDGSEPSSDFPALLVEKLLQEHLEEQEVAPPA
LPPKPPKAKLAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTK
LEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNET
EDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPPPAAR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggtttccagtaccgtgctctgtacccgttccgccgggagcggcca
gaggacctggagctgctgcctggcgacgtgctggtagtgagccgggcggccttgcaggca
ctgggtgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgactttcctggcacctatgtcgagttcctggggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcctgagcagttctcccca
cctgatgtggcgccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccggccggagctgcccacaccgcgtacagactggaccctgagc
gatgtggaccagtgggacgtgacagccttggctgacggcattaagagcttccttctggca
ctgcctgcaccgctcgtgacccccgaggcctcggccgaggcgcgcagggccctgcgggag
gccgcggggcccgtggggccggcgctggagccaccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
tcctcgccgccgccagggggcgctcccgacgggagtgagcccagttctgacttcccggcg
ctgctggtggagaagctgcttcaggagcacttggaagagcaggaggttgcacccccagcg
ctgccgcctaaaccccccaaggcaaagctggcccctgcaggcctggcgaatggagggagc
ccaccctccctgcaggatgccgagtggtactggggagacatttcaagggaggaggtgaat
gagaaactccgggacactcccgatggcaccttcctagtccgagatgcttccagcaagatc
cagggcgagtacacgctgaccctcaggaaaggcgggaacaataaactgatcaaggtcttc
caccgagatgggcactacggcttctcagagccactcaccttctgctctgtcgtggacctc
atcaatcactaccgccacgagtcgctggcccagtacaacgccaagctggacacacggctt
ctctaccctgtgtccaaataccagcaggaccagattgtcaaggaggacagtgtggaggcg
gtgggcgcccagctcaaggtctatcaccagcagtaccaggacaagagccgcgagtatgac
cagctctatgaagagtacacacggacctcccaggagctgcagatgaagcgtaccgcgatt
gaggccttcaatgagactatcaagatctttgaagagcagggccagactcaagagaagtgc
agcaaggaatacctggagcgcttccggcgtgagggcaacgagaaagagatgcagaggatc
ctgcttaactctgagaggctcaagtcccgcattgccgagatccacgagagccgcacgaag
ctggagcagcagctgcgggcccaggcctcggacaaccgggagatcgacaagcgcatgaac
agcctcaagccagacctcatgcagctgcgtaagatccgagaccagtaccttgtgtggctc
acccagaaaggcgcccggcagaagaaaatcaacgagtggctggggatcaaaaatgagact
gaggaccagtacgcgctgatggaggacgaggacgatctcccgcaccacgaggaacgcact
tggtacgtgggcaagatcaaccgcacgcaggcagaggagatgctgagtggcaagcgggat
ggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtggtggtg
gacggagacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcctcgctc
gtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtacgcgccccgggcccc
ggcccgccgcctgccgcccgctga

DBGET integrated database retrieval system