KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662238
Entry
104662238         CDS       T03989                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1 isoform X1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04270  Vascular smooth muscle contraction
rro04911  Insulin secretion
rro04924  Renin secretion
rro04970  Salivary secretion
rro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    104662238 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104662238 (KCNMA1)
   04924 Renin secretion
    104662238 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104662238 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    104662238 (KCNMA1)
   04972 Pancreatic secretion
    104662238 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104662238 (KCNMA1)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   104662238 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N
Other DBs
NCBI-GeneID: 104662238
NCBI-ProteinID: XP_030797035
LinkDB
Position
11
AA seq 989 aa
MAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALR
LIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALT
YWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYG
GSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKR
HFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPK
IRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSM
RSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA
NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRL
KVAARSRYFKDPFEFKKETPNSRLVTQPVEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMR
HDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIF
GDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPL
SRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQ
GFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELY
LTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYS
TPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLST
PSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVH
SIPSTANRQNRPKSRESRDKQKYVQEERL
NT seq 2970 nt   +upstreamnt  +downstreamnt
atggctttcaacgtgttcttccttctctactttggcttgcggtttattgcagccaacgat
aagctgtggttctggctggaagtgaactctgtagtggatttcttcacggtgcctcctgtg
tttgtgtctgtgtacttaaacagaagttggcttggtttgagatttttaagagctctgaga
ctgatacagttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatc
aagctggtgaatctgctctccatatttatcagcacgtggctgactgcagccgggttcatc
catttggtggagaattcaggggacccatgggaaaatttccaaaacaaccaggctctcacc
tactgggaatgtgtctatttactcatggtcacaatgtccaccgttggttatggggatgtt
tatgcaaaaaccacgcttgggcgtctcttcatggtcttcttcatcctcgggggactggcc
atgtttgccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacggg
ggctcctatagtgcggttagtggaagaaagcacattgtggtctgcggacacatcactctg
gagagtgtttccaacttcctgaaggactttctgcataaggaccgggatgacgtcaatgtg
gagatcgtttttcttcataacatctcccccaacctggagctcgaagctctgttcaaacga
cattttactcaggtggaattttatcagggttcagtcctcaatccacacgatcttgcaaga
gtcaagatagagtcagcagatgcctgcctgatccttgccaacaagtactgcgctgacccg
gatgcggaggatgcctcgaacatcatgagagtaatctccataaagaactaccatccgaag
ataagaatcatcactcaaatgctgcagtatcacaacaaggcccatctgctaaacatcccg
agctggaattggaaagaaggtgatgacgcaatctgcctcgcagagctgaagttgggcttc
atagcccagagctgcctggctcaaggcctctccaccatgcttgccaacctcttctccatg
aggtcattcataaagattgaggaagacacgtggcagaaatactacttggaaggagtctca
aatgaaatgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtt
tgtgagctgtgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgcc
aaccgagagagccgtatattaattaatcctggaaaccatcttaagatccaagaaggtact
ttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgcaag
gcctgtcatgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacggctc
aaggttgcagctagatcacgctatttcaaagacccatttgagttcaagaaggaaactccc
aattctcggcttgtgacccagccagttgaagatgagcagccgtcaacgctatcaccaaaa
aaaaagcaacggaatggaggcatgcggaactcacccaactcctcgcctaagctgatgagg
catgaccccttgttaattcctggcaatgaccagattgacaacatggactccaatgtgaag
aagtacgactctactgggatgtttcactggtgcgcgcccaaggagatagagaaggtcatc
ctgactcgaagtgaagccgccatgactgtcctgagtggccatgtcgtggtctgcatcttt
ggcgatgtcagctcagccctgatcggcctccggaacctggtgatgccactccgtgccagc
aactttcattaccatgagctcaagcacattgtgtttgtgggctctattgagtacctcaag
cgggaatgggagacgcttcataacttccccaaagtgtccatattgcctggtacgccatta
agtcgggctgatttaagggctgtcaacatcaacctctgtgacatgtgcgttatcctgtca
gccaatcagaataatattgatgatacttcgctgcaggacaaggaatgcatcttggcgtca
ctcaacatcaaatctatgcagtttgatgacagcatcggggtcttgcaggctaattcccaa
gggttcacacctccaggaatggatagatcctctccagataacagtccagtgcacgggatg
ttacgtcaaccatccatcacaactggggtcaacatccccatcatcactgaactagtgaat
gatactaatgttcagtttttggaccaagacgatgatgatgaccccgatacagaactgtac
ctcacgcagccctttgcctgcgggacagcgtttgccgtcagtgtcctggactcgctcatg
agcgcaacatacttcaatgacaatatcctcaccctgatacggaccctggtgaccggagga
gccacaccggagctggaagctctgattgctgaggagaacgcccttagaggtggctacagc
accccgcagacactggccaatagggaccgctgccgagtggcccagttagctctgctcgat
gggccatttgcagacttaggggatggtggttgttatggtgatctgttctgcaaagctctg
aaaacatataatatgctttgttttggaatttaccggttgagagatgcccacctcagcacc
cccagtcagtgcacaaagaggtatgtcatcaccaaccccccctatgagtttgagctcgtg
ccgacggacctgatcttctgcttaatgcagtttgaccacaacgccggccagtcccgggcc
agcctgtcccattcctcccactcgtcgcagtcctccagcaagaagagctcctctgttcac
tccatcccatccacggcaaaccgacagaaccggcccaagtccagggagtcccgggacaaa
cagaagtacgtgcaggaagagcggctttga

DBGET integrated database retrieval system