KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662252
Entry
104662252         CDS       T03989                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04060  Cytokine-cytokine receptor interaction
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04218  Cellular senescence
rro04350  TGF-beta signaling pathway
rro04380  Osteoclast differentiation
rro04390  Hippo signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104662252 (TGFB2)
   04350 TGF-beta signaling pathway
    104662252 (TGFB2)
   04390 Hippo signaling pathway
    104662252 (TGFB2)
   04068 FoxO signaling pathway
    104662252 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104662252 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104662252 (TGFB2)
   04218 Cellular senescence
    104662252 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104662252 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662252 (TGFB2)
   05206 MicroRNAs in cancer
    104662252 (TGFB2)
   05205 Proteoglycans in cancer
    104662252 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104662252 (TGFB2)
   05212 Pancreatic cancer
    104662252 (TGFB2)
   05225 Hepatocellular carcinoma
    104662252 (TGFB2)
   05226 Gastric cancer
    104662252 (TGFB2)
   05220 Chronic myeloid leukemia
    104662252 (TGFB2)
   05211 Renal cell carcinoma
    104662252 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104662252 (TGFB2)
   05321 Inflammatory bowel disease
    104662252 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104662252 (TGFB2)
   05414 Dilated cardiomyopathy
    104662252 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104662252 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104662252 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662252 (TGFB2)
   05161 Hepatitis B
    104662252 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104662252 (TGFB2)
   05144 Malaria
    104662252 (TGFB2)
   05145 Toxoplasmosis
    104662252 (TGFB2)
   05140 Leishmaniasis
    104662252 (TGFB2)
   05142 Chagas disease
    104662252 (TGFB2)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104662252 (TGFB2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104662252 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 104662252
NCBI-ProteinID: XP_010361554
UniProt: A0A2K6QVN2
LinkDB
Position
8
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgttcggttt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaatccaaaagccagagtgcctgaacaacggattgagctgtatcagattctc
aagtccaaagacttaacatctccaacccagcgctacattgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctttccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacttttgtg
ccatctaataattacatcatcccaaataaaagcgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcggcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggcaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676086
Entry
104676086         CDS       T03989                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04060  Cytokine-cytokine receptor interaction
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04218  Cellular senescence
rro04350  TGF-beta signaling pathway
rro04380  Osteoclast differentiation
rro04390  Hippo signaling pathway
rro04659  Th17 cell differentiation
rro04672  Intestinal immune network for IgA production
rro04926  Relaxin signaling pathway
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676086 (TGFB1)
   04350 TGF-beta signaling pathway
    104676086 (TGFB1)
   04390 Hippo signaling pathway
    104676086 (TGFB1)
   04068 FoxO signaling pathway
    104676086 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104676086 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104676086 (TGFB1)
   04218 Cellular senescence
    104676086 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104676086 (TGFB1)
   04672 Intestinal immune network for IgA production
    104676086 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104676086 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104676086 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676086 (TGFB1)
   05205 Proteoglycans in cancer
    104676086 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104676086 (TGFB1)
   05212 Pancreatic cancer
    104676086 (TGFB1)
   05225 Hepatocellular carcinoma
    104676086 (TGFB1)
   05226 Gastric cancer
    104676086 (TGFB1)
   05220 Chronic myeloid leukemia
    104676086 (TGFB1)
   05211 Renal cell carcinoma
    104676086 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104676086 (TGFB1)
   05321 Inflammatory bowel disease
    104676086 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104676086 (TGFB1)
   05414 Dilated cardiomyopathy
    104676086 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104676086 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104676086 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104676086 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104676086 (TGFB1)
   05161 Hepatitis B
    104676086 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104676086 (TGFB1)
   05144 Malaria
    104676086 (TGFB1)
   05145 Toxoplasmosis
    104676086 (TGFB1)
   05140 Leishmaniasis
    104676086 (TGFB1)
   05142 Chagas disease
    104676086 (TGFB1)
Chaperones and folding catalysts [BR:rro03110]
 Intramolecular chaperones
  Others
   104676086 (TGFB1)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104676086 (TGFB1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104676086 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 104676086
NCBI-ProteinID: XP_010379107
UniProt: A0A2K6RFX0
LinkDB
Position
12
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNQLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccaagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcggagccggagcccgaaccggag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagcacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcagtacctgaacctgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcatgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccagctgctggcgcccagcgactcgccggagtggttgtcttttgatgtc
accggagttgtgcggcagtggttgagccgcggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcaaagataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccaacatctgcaaagctcccggcaccgccgagccctg
gacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctgtatatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctggggccctgcccctacatttggagcctggacacccagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaaatgcagctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677599
Entry
104677599         CDS       T03989                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04060  Cytokine-cytokine receptor interaction
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04218  Cellular senescence
rro04350  TGF-beta signaling pathway
rro04390  Hippo signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05321  Inflammatory bowel disease
rro05323  Rheumatoid arthritis
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104677599 (TGFB3)
   04350 TGF-beta signaling pathway
    104677599 (TGFB3)
   04390 Hippo signaling pathway
    104677599 (TGFB3)
   04068 FoxO signaling pathway
    104677599 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104677599 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104677599 (TGFB3)
   04218 Cellular senescence
    104677599 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677599 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104677599 (TGFB3)
   05212 Pancreatic cancer
    104677599 (TGFB3)
   05225 Hepatocellular carcinoma
    104677599 (TGFB3)
   05226 Gastric cancer
    104677599 (TGFB3)
   05220 Chronic myeloid leukemia
    104677599 (TGFB3)
   05211 Renal cell carcinoma
    104677599 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104677599 (TGFB3)
   05321 Inflammatory bowel disease
    104677599 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677599 (TGFB3)
   05414 Dilated cardiomyopathy
    104677599 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104677599 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104677599 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677599 (TGFB3)
   05161 Hepatitis B
    104677599 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104677599 (TGFB3)
   05144 Malaria
    104677599 (TGFB3)
   05145 Toxoplasmosis
    104677599 (TGFB3)
   05140 Leishmaniasis
    104677599 (TGFB3)
   05142 Chagas disease
    104677599 (TGFB3)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104677599 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 104677599
NCBI-ProteinID: XP_010380986
UniProt: A0A2K6NAM5
LinkDB
Position
5
AA seq 412 aa
MKMHLQRALVVLALLNFASVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggcactgctgaactttgcctcggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccccaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccggatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacacagtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccacggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagagaaagaagcgg
gccttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaggtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

DBGET integrated database retrieval system