KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662575
Entry
104662575         CDS       T03989                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04540  Gap junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104662575 (MAP2K1)
   04012 ErbB signaling pathway
    104662575 (MAP2K1)
   04014 Ras signaling pathway
    104662575 (MAP2K1)
   04015 Rap1 signaling pathway
    104662575 (MAP2K1)
   04370 VEGF signaling pathway
    104662575 (MAP2K1)
   04371 Apelin signaling pathway
    104662575 (MAP2K1)
   04668 TNF signaling pathway
    104662575 (MAP2K1)
   04066 HIF-1 signaling pathway
    104662575 (MAP2K1)
   04068 FoxO signaling pathway
    104662575 (MAP2K1)
   04072 Phospholipase D signaling pathway
    104662575 (MAP2K1)
   04071 Sphingolipid signaling pathway
    104662575 (MAP2K1)
   04024 cAMP signaling pathway
    104662575 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    104662575 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    104662575 (MAP2K1)
   04150 mTOR signaling pathway
    104662575 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104662575 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104662575 (MAP2K1)
   04210 Apoptosis
    104662575 (MAP2K1)
   04218 Cellular senescence
    104662575 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104662575 (MAP2K1)
   04540 Gap junction
    104662575 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104662575 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104662575 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104662575 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    104662575 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    104662575 (MAP2K1)
   04660 T cell receptor signaling pathway
    104662575 (MAP2K1)
   04662 B cell receptor signaling pathway
    104662575 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    104662575 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    104662575 (MAP2K1)
   04062 Chemokine signaling pathway
    104662575 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104662575 (MAP2K1)
   04929 GnRH secretion
    104662575 (MAP2K1)
   04912 GnRH signaling pathway
    104662575 (MAP2K1)
   04915 Estrogen signaling pathway
    104662575 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    104662575 (MAP2K1)
   04917 Prolactin signaling pathway
    104662575 (MAP2K1)
   04921 Oxytocin signaling pathway
    104662575 (MAP2K1)
   04926 Relaxin signaling pathway
    104662575 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    104662575 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    104662575 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    104662575 (MAP2K1)
   04916 Melanogenesis
    104662575 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104662575 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    104662575 (MAP2K1)
   04726 Serotonergic synapse
    104662575 (MAP2K1)
   04720 Long-term potentiation
    104662575 (MAP2K1)
   04730 Long-term depression
    104662575 (MAP2K1)
   04722 Neurotrophin signaling pathway
    104662575 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104662575 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662575 (MAP2K1)
   05206 MicroRNAs in cancer
    104662575 (MAP2K1)
   05205 Proteoglycans in cancer
    104662575 (MAP2K1)
   05230 Central carbon metabolism in cancer
    104662575 (MAP2K1)
   05231 Choline metabolism in cancer
    104662575 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104662575 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104662575 (MAP2K1)
   05212 Pancreatic cancer
    104662575 (MAP2K1)
   05225 Hepatocellular carcinoma
    104662575 (MAP2K1)
   05226 Gastric cancer
    104662575 (MAP2K1)
   05214 Glioma
    104662575 (MAP2K1)
   05216 Thyroid cancer
    104662575 (MAP2K1)
   05221 Acute myeloid leukemia
    104662575 (MAP2K1)
   05220 Chronic myeloid leukemia
    104662575 (MAP2K1)
   05218 Melanoma
    104662575 (MAP2K1)
   05211 Renal cell carcinoma
    104662575 (MAP2K1)
   05219 Bladder cancer
    104662575 (MAP2K1)
   05215 Prostate cancer
    104662575 (MAP2K1)
   05213 Endometrial cancer
    104662575 (MAP2K1)
   05224 Breast cancer
    104662575 (MAP2K1)
   05223 Non-small cell lung cancer
    104662575 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104662575 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    104662575 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    104662575 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104662575 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104662575 (MAP2K1)
   05135 Yersinia infection
    104662575 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662575 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    104662575 (MAP2K1)
   05161 Hepatitis B
    104662575 (MAP2K1)
   05160 Hepatitis C
    104662575 (MAP2K1)
   05164 Influenza A
    104662575 (MAP2K1)
   05163 Human cytomegalovirus infection
    104662575 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662575 (MAP2K1)
   05165 Human papillomavirus infection
    104662575 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104662575 (MAP2K1)
   01522 Endocrine resistance
    104662575 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104662575 (MAP2K1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104662575 (MAP2K1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE7 family
   104662575 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 104662575
NCBI-ProteinID: XP_010361906
UniProt: A0A2K6PWS8
LinkDB
Position
5
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLHQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggctcccgacggctccgcggtt
aacgggaccagctctgcggagaccaacttggaggccttgcagaagaagctggaggagcta
gagcttgatgagcagcagcgaaagcgccttgaggcctttctcacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggggccggcaatggcggt
gtggtgttcaaggtctcccacaagccttctggcctggtcatggccagaaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcataagggagctgcaggttctgcatgag
tgcaactctccatacatcgtgggcttctatggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatggaggttctctggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagatcatgcacagagatgtcaagccctccaacatcctagtcaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tctgtgcagtcagacatctggagcatgggactctctctggtagagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagaccccacccaggccaaggacccccgggaggccccttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaattgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttcaccagcccagcacaccaacccatgctgctggcgtctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665487
Entry
104665487         CDS       T03989                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro04270  Vascular smooth muscle contraction
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104665487 (MAP2K2)
   04012 ErbB signaling pathway
    104665487 (MAP2K2)
   04014 Ras signaling pathway
    104665487 (MAP2K2)
   04015 Rap1 signaling pathway
    104665487 (MAP2K2)
   04370 VEGF signaling pathway
    104665487 (MAP2K2)
   04371 Apelin signaling pathway
    104665487 (MAP2K2)
   04066 HIF-1 signaling pathway
    104665487 (MAP2K2)
   04068 FoxO signaling pathway
    104665487 (MAP2K2)
   04072 Phospholipase D signaling pathway
    104665487 (MAP2K2)
   04071 Sphingolipid signaling pathway
    104665487 (MAP2K2)
   04024 cAMP signaling pathway
    104665487 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    104665487 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    104665487 (MAP2K2)
   04150 mTOR signaling pathway
    104665487 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104665487 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    104665487 (MAP2K2)
   04218 Cellular senescence
    104665487 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104665487 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    104665487 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104665487 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104665487 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    104665487 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    104665487 (MAP2K2)
   04660 T cell receptor signaling pathway
    104665487 (MAP2K2)
   04662 B cell receptor signaling pathway
    104665487 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    104665487 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104665487 (MAP2K2)
   04929 GnRH secretion
    104665487 (MAP2K2)
   04912 GnRH signaling pathway
    104665487 (MAP2K2)
   04915 Estrogen signaling pathway
    104665487 (MAP2K2)
   04917 Prolactin signaling pathway
    104665487 (MAP2K2)
   04921 Oxytocin signaling pathway
    104665487 (MAP2K2)
   04926 Relaxin signaling pathway
    104665487 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    104665487 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    104665487 (MAP2K2)
   04916 Melanogenesis
    104665487 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104665487 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    104665487 (MAP2K2)
   04730 Long-term depression
    104665487 (MAP2K2)
   04722 Neurotrophin signaling pathway
    104665487 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104665487 (MAP2K2)
   05206 MicroRNAs in cancer
    104665487 (MAP2K2)
   05205 Proteoglycans in cancer
    104665487 (MAP2K2)
   05230 Central carbon metabolism in cancer
    104665487 (MAP2K2)
   05231 Choline metabolism in cancer
    104665487 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104665487 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104665487 (MAP2K2)
   05225 Hepatocellular carcinoma
    104665487 (MAP2K2)
   05226 Gastric cancer
    104665487 (MAP2K2)
   05214 Glioma
    104665487 (MAP2K2)
   05216 Thyroid cancer
    104665487 (MAP2K2)
   05221 Acute myeloid leukemia
    104665487 (MAP2K2)
   05220 Chronic myeloid leukemia
    104665487 (MAP2K2)
   05218 Melanoma
    104665487 (MAP2K2)
   05211 Renal cell carcinoma
    104665487 (MAP2K2)
   05219 Bladder cancer
    104665487 (MAP2K2)
   05215 Prostate cancer
    104665487 (MAP2K2)
   05213 Endometrial cancer
    104665487 (MAP2K2)
   05224 Breast cancer
    104665487 (MAP2K2)
   05223 Non-small cell lung cancer
    104665487 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104665487 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    104665487 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104665487 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104665487 (MAP2K2)
   05135 Yersinia infection
    104665487 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104665487 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    104665487 (MAP2K2)
   05161 Hepatitis B
    104665487 (MAP2K2)
   05160 Hepatitis C
    104665487 (MAP2K2)
   05164 Influenza A
    104665487 (MAP2K2)
   05163 Human cytomegalovirus infection
    104665487 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104665487 (MAP2K2)
   05165 Human papillomavirus infection
    104665487 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104665487 (MAP2K2)
   01522 Endocrine resistance
    104665487 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104665487 (MAP2K2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104665487 (MAP2K2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE7 family
   104665487 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 104665487
NCBI-ProteinID: XP_030791611
LinkDB
Position
8
AA seq 400 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVVDGEEGEPRSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADL
KMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAM
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccctaccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaggcaaacctggtggacctgcagaagaag
ctggaggagctggaactggacgagcagcagaagaagcgtctggaagcctttctgacccag
aaagccaaggtcggcgaactcaaagacgatgacttcgaaaggatctcagagctgggcgcg
ggcaacggcggggtggtcaccaaagtccagcacagaccctcgggcctcatcatggccagg
aagctgatccaccttgagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtcctgcatgagtgcaactcgccatacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgctgaag
gaggccaagaggatccccgaggagatcctggggaaagtcagcatcgcggttctccggggc
ttggcgtatctccgagagaagcaccagatcatgcaccgagatgtgaagccctccaacatc
cttgtgaactccagaggggagatcaagctgtgtgacttcggggtgagcggccagctcatc
gactccatggccaactccttcgtgggcacacgctcctacatggctccggagcgattgcag
ggcacacattactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
gccatcggaaggtaccccatccccccgcccgacgccaaggagctggaggccatctttggc
cggccagtggtcgacggggaagaaggagagcctcgcagcatctcgcctcggccgagaccc
cccgggcgccccatcagcggtcacgggatggacagccggcccgccatggccatcttcgaa
ttgctggactatattgtgaatgagccgcctcccaagctgcccaacggtgtgttcaccccc
gacttccaggagtttgtcaataaatgcctcatcaagaacccagcagagcgggcggacctg
aagatgctcacgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
gggtggttgtgtaaaaccctgcgactgaaccagcccggcacacccacgcgtaccgccatg
tga

DBGET integrated database retrieval system