KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662580
Entry
104662580         CDS       T03989                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X2
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04144  Endocytosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04350  TGF-beta signaling pathway
rro04371  Apelin signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04659  Th17 cell differentiation
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104662580 (SMAD3)
   04350 TGF-beta signaling pathway
    104662580 (SMAD3)
   04390 Hippo signaling pathway
    104662580 (SMAD3)
   04371 Apelin signaling pathway
    104662580 (SMAD3)
   04068 FoxO signaling pathway
    104662580 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104662580 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    104662580 (SMAD3)
   04218 Cellular senescence
    104662580 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104662580 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    104662580 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104662580 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662580 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104662580 (SMAD3)
   05212 Pancreatic cancer
    104662580 (SMAD3)
   05225 Hepatocellular carcinoma
    104662580 (SMAD3)
   05226 Gastric cancer
    104662580 (SMAD3)
   05220 Chronic myeloid leukemia
    104662580 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    104662580 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104662580 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662580 (SMAD3)
   05161 Hepatitis B
    104662580 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 104662580
NCBI-ProteinID: XP_010361914
UniProt: A0A2K6NPB3
LinkDB
Position
5
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNA
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggtgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaagaagacggggcaactggacgagctggagaaggccatcaccacgcagaacgcc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccggacctgcacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctgtccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcacagccatccatgactgtggacggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacgcggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgctgccctcctggcccagtctgtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgtaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccttgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system