KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662589
Entry
104662589         CDS       T03989                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04630  JAK-STAT signaling pathway
rro05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104662589 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104662589 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    104662589 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104662589 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104662589 (PIAS1)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     104662589 (PIAS1)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   104662589 (PIAS1)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    104662589 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 104662589
NCBI-ProteinID: XP_010361929
UniProt: A0A2K6NYY5
LinkDB
Position
5
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHGHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtacttttgggctacgctgggaggaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaaggaactc
tataggcggcggttcccgcagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttacgat
ggtcaccctgcatcatcgccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacgtcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcgtttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggacatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcggatcca
gacagtgaaatagctacaaccagcctaagggtttctctactgtgtccacttggtaaaatg
cggctgacaattccatgtcgggcccttacatgttctcatctacaatgttttgatgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacaatttaaggaggatggcacttgggcaccaatgagatcgaaaaag
gaagtacaagaagtttctgcctcttacaatggagtcgatggatgcttgagctccacattg
gagcatcaagtagcttctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacg
tgtccttccctttctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcagcagccgtttcagatgatcaagacctcctacactcgtctcggttt
tttccgtatacctcttcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcttccaacagc
ctcagggagagccatggccacactgtcacaaacaggagcagcacggacacggcatccatc
tttggcatcataccagacattatttcactggactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104665429
Entry
104665429         CDS       T03989                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4 isoform X1
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04064  NF-kappa B signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04630  JAK-STAT signaling pathway
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104665429 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104665429 (PIAS4)
   04064 NF-kappa B signaling pathway
    104665429 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104665429 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104665429 (PIAS4)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104665429 (PIAS4)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   104665429 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Other DBs
NCBI-GeneID: 104665429
NCBI-ProteinID: XP_030792248
LinkDB
Position
8
AA seq 510 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAQQPHRPLDPLTMHSTYDRVGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSSALGSTGGGGPVGGVENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEEEDEEGPRPKRRCPFQKGLVPAC
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagcggactgaagcacgagctcgtcacc
agggccctccagctggtgcagtttgactgtagccccgagctgttcaaaaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgcccaacagccgcaccggccc
ctggaccccctgaccatgcactccacctacgaccgggtcggcgctgtgcccaggactccc
ctggcaggccccaatattgactaccccgtgctctacgggaagtacttaaacggactggga
cggttgcctgccaagacccttaagccagaagtccgcctagtgaagctgcccttctttaat
atgctggacgagctgctgaagcccaccgagttagtcccacagaacaacgagaagcttcag
gagagcccgtgcatcttcgcgttgacgccaagacaagtggagttgatccggaactccaga
gaactgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagacacc
agctgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctac
tgctcagtcccgggctactacccctccaacaagcctggggtggagcccaagaggccgtgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtc
acctggggcaactacggcaagagctactctgtggccctgtacctggtacggcagttgacc
tcgtcagagctgctgcagaggctgaagaccattggggtgaagcacccggagctgtgcaag
gcgctggtcaaggagaagctgcgcctcgatcccgacagcgagatcgccaccacaggtgtg
cgggtgtccctcatctgcccgctggtgaagatgcgactctctgtgccctgccgggcagag
acgtgcgcccacctgcagtgcttcgacgccgtcttctacctgcagatgaatgagaagaag
cccacctggatgtgccccgtgtgcgacaagccagccccctacgaccagctcatcatcgat
gggctcctctcgaagatcctgagcgagtgtgaggacgctgacgagatcgaatacctggtg
gacggttcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgcc
atcctcgtgctgggcccctcggatgccaacgggctcctgcctgcccccagcgtcaacggg
agcagtgccctgggcagcacgggtggcggcggcccggtgggcggcgtggagaatggaaag
ccgggcgccgacgtggtggacctcacgctggacagctcatcgtcctcagaggatgaggag
gaagaggaggaggaggaggaggaggaggacgaagagggcccccggcccaagcgccgctgc
ccctttcagaagggcctggtgccggcctgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671049
Entry
104671049         CDS       T03989                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104671049 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104671049 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104671049 (PIAS3)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     104671049 (PIAS3)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   104671049 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 104671049
NCBI-ProteinID: XP_010372748
UniProt: A0A2K6Q725
LinkDB
Position
8
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGALGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagcttcag
gtgcttcttggctttgctggccggaacaagagtgggcggaagcacgagctcctggccaag
gccctgcacctcctgaagtccagctgtgcccctagcgtccagatgaagatcaaagagctg
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaaccctc
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctacggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagcgaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggctgagcccaagaggcccagccgc
cccatcaacatcacacctctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaacttagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgatcctgacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctcactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcccacgtggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggagggaaatccatcggag
aataagaagaaggtcgaagttattgacttgacaatagaaagttcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccagccctacctgga
agcaaaggagtcctgacgtctggccaccagccatcctcggtgctaaggagccctgccatg
ggtgcgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgatatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctccgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgttggggagctcc
caccgcagtgccactccggcgccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctaccctcaggtccttctttgactggctgt
cggtcagacatcatttccctggactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680745
Entry
104680745         CDS       T03989                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04120  Ubiquitin mediated proteolysis
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104680745 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680745 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104680745 (PIAS2)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     104680745 (PIAS2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   104680745 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 104680745
NCBI-ProteinID: XP_030781862
LinkDB
Position
21
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSS
SRSETGVITSSGSNIPDIISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagggtttctgaactgcaa
gtattactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgctgcatttattgaagagtggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatca
tcggttttcagtttggatggtagctcatcacctgtagaacctgacttggccgtggctgga
atccactctttgccttccacttcagttacacctcactcaccatcctctcctgttggttct
gtgctgcttcaagatactaagcccacatttgagatgcagcagccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacaagttgc
cctcaagaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcct
ttgcctggctacgcaccaccacctaaaaatgggattgaacagaagcgccctggacgcccc
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttct
tgggcatcagaaattgggaagaattactccatgtctgtatatcttgtacggcagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttaggaaaaatgagactgacaatcccatgccgtgcagtg
acttgtacacatctgcagtgttttgatgctgccctttatctacaaatgaatgagaagaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaggaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccg
tgtacaaaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtagatgttattgatcttacaatagaaagctcttctgatgaa
gaagaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccacacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagc
agtacgtctgtcaccaccaccagctcccatgaaagcagtactcacgttagttcatccagc
agcaggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctca
ttggactaa

DBGET integrated database retrieval system