KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662694
Entry
104662694         CDS       T03989                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro05160  Hepatitis C
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104662694 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104662694 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104662694 (IRF9)
   04625 C-type lectin receptor signaling pathway
    104662694 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104662694 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104662694 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104662694 (IRF9)
   05171 Coronavirus disease - COVID-19
    104662694 (IRF9)
   05164 Influenza A
    104662694 (IRF9)
   05162 Measles
    104662694 (IRF9)
   05168 Herpes simplex virus 1 infection
    104662694 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662694 (IRF9)
   05169 Epstein-Barr virus infection
    104662694 (IRF9)
   05165 Human papillomavirus infection
    104662694 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104662694 (IRF9)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    104662694 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 104662694
NCBI-ProteinID: XP_010362078
UniProt: A0A2K6P094
LinkDB
Position
5
AA seq 392 aa
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSTEFEEVPKRGRMDVAEPYKVYRLLPPGTF
SGQPGTQKSPSKRQHSSVSSERKEEAGAIQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSPEPQEGTDTTEAPFQGDQRSLEFLLPPESDYSLLLTFIYNGRVVGEAQVQSLDC
RLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWN
APQAPPGPGPHLLPSNECVELFRTAYFCRDLVKYFQGLGPPPKFQVTLNFWEESRGPSHT
PQNLITVKMEQAFARYLLEETPEQQAAILSLV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgtacccgaaaactccggaactgggtggtggagcaagtg
gagagcgggcagttccccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaagcatgcaggcaagcaggacttccgagaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggaaggggacacaggaggccccgctgtctgg
aagactcgcctgcgctgtgcactcaacaagagtactgaatttgaggaggttcctaagagg
ggccgcatggatgttgctgagccctacaaggtgtatcggctgctgccaccaggaaccttc
tctggccagccagggactcagaaatcaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagcgggtgccatacagaactgcacactcagtccttctgtgctccag
gactccctcaataatgaggaggagggggccagtgggggagcagtccattcagacatcggg
agcagcagcagcagcagccctgagccacaggaaggtacagacacaactgaggcccccttt
caaggggatcagaggtccctggagtttctgcttcctccagagtcagactactcactgctg
ctcaccttcatctacaacggacgtgtggtgggcgaggcccaggtgcaaagcctggattgc
cgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttccccaag
cctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatcctggtg
gccagcaacccccgaggcctctttgtgcagcgcctttgccccattcccatctcctggaat
gcaccccaggctccccctgggccaggcccgcatctgctgcccagcaacgagtgcgtggag
ctcttcagaaccgcctacttctgcagagacttggtcaagtacttccagggcctaggcccc
ccaccgaagttccaggtaacactgaatttctgggaagagagccgtggccccagccatact
ccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggaggag
actccagagcagcaggcagccattctgtccctggtgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115897716
Entry
115897716         CDS       T03989                                 

Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro05160  Hepatitis C
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    115897716
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    115897716
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    115897716
   04625 C-type lectin receptor signaling pathway
    115897716
  09158 Development and regeneration
   04380 Osteoclast differentiation
    115897716
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    115897716
  09172 Infectious disease: viral
   05160 Hepatitis C
    115897716
   05171 Coronavirus disease - COVID-19
    115897716
   05164 Influenza A
    115897716
   05162 Measles
    115897716
   05168 Herpes simplex virus 1 infection
    115897716
   05167 Kaposi sarcoma-associated herpesvirus infection
    115897716
   05169 Epstein-Barr virus infection
    115897716
   05165 Human papillomavirus infection
    115897716
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    115897716
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    115897716
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 115897716
NCBI-ProteinID: XP_030787462
LinkDB
Position
5
AA seq 392 aa
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSTEFEEVPKRGRMDVAEPYKVYRLLPPGTF
SGQPGTQKSPSKRQHSSVSSERKEEAGAIQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSPEPQEGTDTTEAPFQGDQRSLEFLLPPESDYSLLLTFIYNGRVVGEAQVQSLDC
RLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWN
APQAPPGPGPHLLPSNECVELFRTAYFCRDLVKYFQGLGPPPKFQVTLNFWEESRGPSHT
PQNLITVKMEQAFARYLLEETPEQQAAILSLV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgtacccgaaaactccggaactgggtggtggagcaagtg
gagagcgggcagttccccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaagcatgcaggcaagcaggacttccgagaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggaaggggacacaggaggccccgctgtctgg
aagactcgcctgcgctgtgcactcaacaagagtactgaatttgaggaggttcctaagagg
ggccgcatggatgttgctgagccctacaaggtgtatcggctgctgccaccaggaaccttc
tctggccagccagggactcagaaatcaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagcgggtgccatacagaactgcacactcagtccttctgtgctccag
gactccctcaataatgaggaggagggggccagtgggggagcagtccattcagacatcggg
agcagcagcagcagcagccctgagccacaggaaggtacagacacaactgaggcccccttt
caaggggatcagaggtccctggagtttctgcttcctccagagtcagactactcactgctg
ctcaccttcatctacaacggacgtgtggtgggcgaggcccaggtgcaaagcctggattgc
cgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttccccaag
cctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatcctggtg
gccagcaacccccgaggcctcttcgtgcagcgcctttgccccattcccatctcctggaat
gcaccccaggctccccctgggccaggcccgcatctgctgcccagcaacgagtgcgtggag
ctcttcagaaccgcctacttctgcagagacttggtcaagtacttccagggcctaggcccc
ccaccgaagttccaggtaacactgaatttctgggaagagagccgtggccccagccatact
ccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggaggag
actccagagcagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system