KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662760
Entry
104662760         CDS       T03989                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04110  Cell cycle
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104662760 (RB1)
   04218 Cellular senescence
    104662760 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662760 (RB1)
   05203 Viral carcinogenesis
    104662760 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104662760 (RB1)
   05225 Hepatocellular carcinoma
    104662760 (RB1)
   05226 Gastric cancer
    104662760 (RB1)
   05214 Glioma
    104662760 (RB1)
   05220 Chronic myeloid leukemia
    104662760 (RB1)
   05218 Melanoma
    104662760 (RB1)
   05219 Bladder cancer
    104662760 (RB1)
   05215 Prostate cancer
    104662760 (RB1)
   05224 Breast cancer
    104662760 (RB1)
   05222 Small cell lung cancer
    104662760 (RB1)
   05223 Non-small cell lung cancer
    104662760 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104662760 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104662760 (RB1)
   05161 Hepatitis B
    104662760 (RB1)
   05160 Hepatitis C
    104662760 (RB1)
   05163 Human cytomegalovirus infection
    104662760 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104662760 (RB1)
   05169 Epstein-Barr virus infection
    104662760 (RB1)
   05165 Human papillomavirus infection
    104662760 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104662760 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104662760 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104662760 (RB1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104662760 (RB1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    104662760 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 FAM75
Other DBs
NCBI-GeneID: 104662760
NCBI-ProteinID: XP_010362160
UniProt: A0A2K6Q3D3
LinkDB
Position
18
AA seq 929 aa
MPPKTPRKTAAAAAAAAAEPPALPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTA
LCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTE
LQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSS
SISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPY
KTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPF
MNSLGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRK
SNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRV
KDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLND
NIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAE
GNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHFESACPLNLPLQNN
HTAADMYLSPVRSPKKKGSTTRVNSTANAETQTTSAFQTQKPLKSTSLSLFYKKVYRLAY
LRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDL
KFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTL
SPIPHIPRSPYKFPTSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESF
GTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQ
KLAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgccgcccaaaactccccgaaaaacggccgccgccgccgccgctgctgccgcggaaccc
ccggcactgccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccg
gaggacctgcctctggtcaggcttgagtttgaagaaaccgaagaacctgattttactgcg
ttatgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggag
aaagtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgg
ggaatctgtatctttattgcagcggttgacctagatgagatgccattcacttttactgag
ctacagaaaaacatagaaatcagtgtccataaattctttaacttactaaaggaaattgat
accagtaccaaagttgataatgctatgtcaagactattgaagaagtatgatgtattgttt
gcactcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagt
tcgatatctactgaaataaattctgcattggtgctaaaagtttcttggatcacattttta
ttagctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatg
ctatgtgtccttgactattttattaaactctcacctcctgtgttgctcaaagaaccatat
aaaacagctgttatacccattaatggttcacctcgaacacccaggcgaggccagaacagg
agtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaa
gaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatacctttt
atgaattctcttggacttgtaacatctaatgggcttccagaggttgaaagtctgtctaaa
cgatatgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcat
gataagactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaa
agtaaccttgatgaagaggtgaatgtgattcctccacacactccagttaggactgttatg
aacactatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaat
ctgatttcctattttaataactgcacagtgaatcccaaagaaagcatactgaaaagagtg
aaggatataggatacatctttaaagagaaatttgctaaagctgtgggacagggatgtgtc
gaaattggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatcc
atgcttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgac
aacatttttcatatgtccttattggcgtgtgctcttgaggttgtaatggccacatatagc
agaagtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaat
gtgcttaatttgaaagcctttgatttttacaaagtgattgaaagttttataaaagcagaa
ggcaacttgacaagagaaatgataaaacacttagaacgatgtgaacatcgaatcatggaa
tcccttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccga
gaaggaccaactgatcactttgaatctgcttgtcctcttaatcttcctctccagaataat
cacactgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaact
acacgtgtaaattctactgcaaatgcagagacacaaacaacctcagccttccagacccag
aagccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcttat
ctccggctaaatacactatgtgaacgccttctatctgaacacccagaactagaacacatc
atctggacccttttccagcacacgctgcagaatgagtatgaactcatgagagacaggcat
ttggaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagacctt
aaattcaaaatcatcgtaacagcatataaggatcttcctcatgctgttcaggagacattc
aaacgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtc
ttcatgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttg
tcaccaatacctcacattcctcgaagtccttacaagtttcctacttcacccttacggatt
cctggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctc
ccaacaccaacaaaaatgactccaagatcaaggatcttagtatcaattggtgaatcattt
gggacttctgagaagttccagaaaataaatcagatggtgtgtaacagcgaccgtgtgctc
aaaagaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatatt
gaaggatcagatgaagcagatggaagtaaacatctcccaggggagtccaaatttcagcag
aaactggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagc
atggatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system