KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662932
Entry
104662932         CDS       T03989                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04350  TGF-beta signaling pathway
rro04371  Apelin signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04931  Insulin resistance
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104662932 (RPS6KB1)
   04350 TGF-beta signaling pathway
    104662932 (RPS6KB1)
   04371 Apelin signaling pathway
    104662932 (RPS6KB1)
   04066 HIF-1 signaling pathway
    104662932 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    104662932 (RPS6KB1)
   04152 AMPK signaling pathway
    104662932 (RPS6KB1)
   04150 mTOR signaling pathway
    104662932 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104662932 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104662932 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104662932 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    104662932 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    104662932 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    104662932 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104662932 (RPS6KB1)
   05205 Proteoglycans in cancer
    104662932 (RPS6KB1)
   05231 Choline metabolism in cancer
    104662932 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104662932 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104662932 (RPS6KB1)
   05212 Pancreatic cancer
    104662932 (RPS6KB1)
   05225 Hepatocellular carcinoma
    104662932 (RPS6KB1)
   05226 Gastric cancer
    104662932 (RPS6KB1)
   05221 Acute myeloid leukemia
    104662932 (RPS6KB1)
   05224 Breast cancer
    104662932 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104662932 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104662932 (RPS6KB1)
   05163 Human cytomegalovirus infection
    104662932 (RPS6KB1)
   05165 Human papillomavirus infection
    104662932 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104662932 (RPS6KB1)
   01522 Endocrine resistance
    104662932 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104662932 (RPS6KB1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104662932 (RPS6KB1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   104662932 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 104662932
NCBI-ProteinID: XP_010362368
UniProt: A0A2K6R1V3
LinkDB
Position
19
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctca
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatacgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtgagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcct
ggggacgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagt
cagtttgattccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggc
atagagcagatggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatatccaaacggccagagcac
ttgcgtatgaatctatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664740
Entry
104664740         CDS       T03989                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04350  TGF-beta signaling pathway
rro04371  Apelin signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04931  Insulin resistance
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104664740 (RPS6KB2)
   04350 TGF-beta signaling pathway
    104664740 (RPS6KB2)
   04371 Apelin signaling pathway
    104664740 (RPS6KB2)
   04066 HIF-1 signaling pathway
    104664740 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    104664740 (RPS6KB2)
   04152 AMPK signaling pathway
    104664740 (RPS6KB2)
   04150 mTOR signaling pathway
    104664740 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104664740 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104664740 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104664740 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    104664740 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    104664740 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    104664740 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104664740 (RPS6KB2)
   05205 Proteoglycans in cancer
    104664740 (RPS6KB2)
   05231 Choline metabolism in cancer
    104664740 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104664740 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104664740 (RPS6KB2)
   05212 Pancreatic cancer
    104664740 (RPS6KB2)
   05225 Hepatocellular carcinoma
    104664740 (RPS6KB2)
   05226 Gastric cancer
    104664740 (RPS6KB2)
   05221 Acute myeloid leukemia
    104664740 (RPS6KB2)
   05224 Breast cancer
    104664740 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104664740 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104664740 (RPS6KB2)
   05163 Human cytomegalovirus infection
    104664740 (RPS6KB2)
   05165 Human papillomavirus infection
    104664740 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104664740 (RPS6KB2)
   01522 Endocrine resistance
    104664740 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104664740 (RPS6KB2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104664740 (RPS6KB2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   104664740 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal FTA2 Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 104664740
NCBI-ProteinID: XP_010364647
UniProt: A0A2K6RQ89
LinkDB
Position
15
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEGEPELSSADVCPLAELRAAGLEPVGHYEEVELTETSVNLC
PERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTQA
ERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFMHLEREGIFLEDTACFYLAEI
TLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAP
EILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLALPPYLTPDARD
LVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLARRVDPPFRPCLQSEEDVSQF
DTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSP
RAPISPLKFSPFEGFRPSPSLPEPVEPPLPPLLPPPPPPSITAPLPIRPPSGTKKSKRGR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatttggatttggagacggaggaaggcagcgagggcgagggcgag
ggtgagccagagctcagctccgcggacgtgtgtccccttgccgagttgagggcagctggc
ctggagcctgtgggacactatgaagaggtggagctgactgagaccagcgtgaacctctgc
ccagagcgcatcgggccccactgctttgagctgctgcgtgtgctgggcaaggggggctat
ggcaaggtgttccaggtgcgaaaggtgcaaggcaccaacttgggcaaaatatatgccatg
aaagtcctaaggaaggccaaaattgtgcgcaacgccaaggacacagcacacacacaggct
gagcggaacattctagagtctgtgaagcacccctttattgtggaactggcctatgccttc
cagactggtggcaaactctacctcatccttgagtgcctcagtggtggcgagctcttcatg
catctggagcgagagggcatcttcctggaagatacagcctgcttctacctggctgagatc
acgctggccctgggccatctccattcccagggcatcatctaccgggacctcaagcccgag
aacatcatgctcagcagccagggccacatcaaactgactgactttggactctgcaaggag
tcgatccatgagggcgccgtcactcacaccttctgcggcaccattgagtacatggcccct
gagattctggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctg
atgtacgacatgctcactggatcgccccccttcactgcagagaaccggaagaaaaccatg
gataagatcatcaagggcaagctggcgctgcccccctacctcaccccagatgcccgggac
cttgtcaaaaagtttctgaaacggaatcccagccagaggattgggggtggtccaggggat
gctgctgatgtgcagaggcatccctttttccggcacatgaattgggacgaccttctggcc
cggcgtgtggacccccctttcaggccctgtctgcagtcagaggaggacgtgagccagttt
gatacccgcttcacacggcagacgccggtggacagtcccgatgacacggccctcagcgag
agtgccaaccaggccttcctgggcttcacgtacgtggcgccgtctgtcctggacagcatc
aaggagggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagtagcccc
cgggcccccatcagccccctcaagttctccccctttgaggggtttcggcccagccccagc
ctgccggagcccgtggagccacctctacctccactcctgccaccgccaccaccaccctcg
atcaccgcccctctccccatccgtcccccctcagggaccaagaagtccaagaggggccgt
gggcgtccaggacgctag

DBGET integrated database retrieval system