KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663087
Entry
104663087         CDS       T03989                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00564  Glycerophospholipid metabolism
rro00565  Ether lipid metabolism
rro01100  Metabolic pathways
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04666  Fc gamma R-mediated phagocytosis
rro04724  Glutamatergic synapse
rro04912  GnRH signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05200  Pathways in cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104663087 (PLD2)
   00565 Ether lipid metabolism
    104663087 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104663087 (PLD2)
   04072 Phospholipase D signaling pathway
    104663087 (PLD2)
   04071 Sphingolipid signaling pathway
    104663087 (PLD2)
   04024 cAMP signaling pathway
    104663087 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104663087 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104663087 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104663087 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    104663087 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104663087 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663087 (PLD2)
   05231 Choline metabolism in cancer
    104663087 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104663087 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104663087 (PLD2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     104663087 (PLD2)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104663087 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    104663087 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 104663087
NCBI-ProteinID: XP_010362527
UniProt: A0A2K6RBN4
LinkDB
Position
19
AA seq 933 aa
MMATPESLFPTGGELDSSQLQMESDEVDTLREGEDPADRMHPFLAIYELQPLKVHPLVFA
TGVPVTARVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAQDAANREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHALTEFLEVSQLSFIPDLGCKGLEGTIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELARGPGRDFLQLHQHDSYAPPRPGTMARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAVSQPPTPCPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKIPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIKESRHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVTELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGVEYQAGSFALSLRKHCFSVILGANTRPDLDLRDPVCD
DFFQLWQDTAESNANIYEQIFRCLPTNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMVPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgatggcgacccctgagagcctcttccccactgggggcgagctggactccagccagctc
cagatggagtccgatgaggtggacactctgagggagggagaggacccagccgaccggatg
cacccgtttctggccatctatgagcttcagcctctgaaagtgcaccccttggtgttcgca
actggggtccctgtcacagcccgggtggtgggcaccgaaagatacaccagcggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcacggcgactttacctggacaacc
aagaagaagtttcgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgttttgccgttgcctattctccagcccaagatgcagcc
aacagagagatgccctctctaccccgggcaggtcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgcctcttgaccatgtctttctatcgc
aactaccatgctttgacagaattcctggaagtcagtcagctgtcctttatcccagacctg
ggctgcaaaggactggaggggacgatccggaagcgctcaggtggccaccgcgttcctggt
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacgggtgccatctcatttgttcagctc
tttgaccctggctttgaggtgcaggtggggaaaaggagcacggaggcacggtacggcgtg
cggatcgacacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcgcggggcccaggccgagacttcctacagctg
caccagcatgacagctatgccccaccccggcctgggaccatggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgcgtgtccattctg
ctgtttaaggaagtggaattggccttgggcatcaacagtggctatagcaagagggcactg
atgctgctgcaccccaatataaaggtgatgcgtcacccagaccaagtgacactgtgggct
caccatgagaagctcctggtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgtctcccagcctcccaccccgtgcccagactcgccggccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctcgaccggcctttcgaagatttcattgacagggagacgacccctcggatgccatgg
cgggatgttggggtggtcgtccatggcctacctgcccgggacctcgcccggcacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagattcccacgtacccctac
ctgcttcccaagtctaccagcactgccaaccagctccccttcacgctcccaggggggcag
tgcaccactgtgcaggtcttgcggtcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctccacaccatcaaggagagccggcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgtttccgagtctacgtgctt
ttgcccttactccctggcttcgagggcgacatctccacgggtggtggcaactccattcag
gctattctgcattttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
ctcaaagcagccatggggacagcatggcgggactatatttccatctgtgggcttcgtaca
catggagagctgggcgggcaccccgtcacggagctcatctacatccacagcaagatgctc
atcgcagatgaccggacggtcatcatcggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacggaaccatccctc
atgaatggggtggagtatcaggcaggcagctttgccttgagtctgaggaagcactgcttc
agtgtcattcttggagcaaatacccggccagacttggacctccgagaccccgtctgtgat
gacttcttccagctgtggcaagacacagctgagagcaacgctaatatctatgagcagatc
ttccgctgcctaccgaccaatgccacgcgttccctgcggacactccgggagtatgtggcc
gtggagcccttggccacagtcagtcctcccttggctcggtctgagctcacccaggtccag
ggccacctggtccacttccccctcaagttcctagaggatgagtctttactgcccccgctg
ggtagcaaggagggcatggtccccctagaagtgtggacatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666985
Entry
104666985         CDS       T03989                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00564  Glycerophospholipid metabolism
rro00565  Ether lipid metabolism
rro01100  Metabolic pathways
rro04014  Ras signaling pathway
rro04024  cAMP signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04666  Fc gamma R-mediated phagocytosis
rro04724  Glutamatergic synapse
rro04912  GnRH signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05200  Pathways in cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104666985 (PLD1)
   00565 Ether lipid metabolism
    104666985 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104666985 (PLD1)
   04072 Phospholipase D signaling pathway
    104666985 (PLD1)
   04071 Sphingolipid signaling pathway
    104666985 (PLD1)
   04024 cAMP signaling pathway
    104666985 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104666985 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    104666985 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104666985 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    104666985 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104666985 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104666985 (PLD1)
   05231 Choline metabolism in cancer
    104666985 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104666985 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104666985 (PLD1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     104666985 (PLD1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104666985 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    104666985 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 104666985
NCBI-ProteinID: XP_030785278
LinkDB
Position
1
AA seq 1073 aa
MSLKTESRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVYIPFSA
VYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTRVPSINLYTIELTHGEFKWQVKRKFK
HFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRRK
QLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNCC
GQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGLRIDN
LSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKGY
FEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLYK
EVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGID
LAYGRWDDNEHRLTDVGSVKRVTSGPSLCSLPPAATESMESLSLKDKNEPDQNLPIRNSV
DDVDSKLKGIGKPRKFSKFSLYRQLHRHHLHNADSISSIDSTSSCFNHYRSHHNLIHGLK
PHFKLFRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQLD
KPFADFIDRYSMPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLLP
KSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIEN
QFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQA
IMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLI
ADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCFR
VVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDDVHNLIQLRDFIN
KPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaccgagtcacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gaatacgacgtgtctcccagcgatcccaagatacaggaagtgtatatccctttctctgct
gtttataacactcaaggatttaaggagcctaatatacagacgtatctctctggctgtcca
ataaaagcacaagttttggaagtggaacgcttcacatctacaagggtaccaagtattaat
ctttatactattgaattaacacatggggaatttaaatggcaagttaagaggaaattcaag
cactttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatccccatt
cccaccagaagacacacatttaggaggcaaaacgtcagagaggagcctcgagagatgccc
agtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaagaaaa
caactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcatgcc
acaacagagtttcttgatataagccagctatctttcatccatgatttgggaccaaagggc
atagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgctgt
ggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattccttt
ttactgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaagaa
ttcaaaattaaggtggggaagaaggagacagaaacgaaatatggactccgaattgataat
ctttcaaggacacttattttaaaatgcaacagctatagacatgctcgttggtggggaggg
gctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgatttggg
tcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaaggatat
tttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagattgg
tggctgagtccagaaatcttcctgaaacgcccggtggttgagggaaatcgttggaggttg
gactgcattcttaaacgaaaagcacaacaaggggtgaggatcttcataatgctctacaaa
gaggtggaactcgctcttggcatcaatagtgaatacaccaagaggacgttgatgcgtcta
caccccaacataaaggtgatgagacatccggatcatgtgtcgtccaccgtctatttgtgg
gctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtaggagggattgac
ttggcctatggaaggtgggatgacaatgagcacagactcacagacgtgggcagcgtgaag
cgggtcacttcaggaccatcactgtgttccctcccacctgccgcaacagagtctatggaa
tccttaagcctcaaagataaaaatgagcctgatcaaaacctgcccatccggaatagtgtt
gatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaatttagt
ctctacaggcagctccacaggcaccacctgcacaacgcagatagcatcagcagcattgac
agcacctccagttgttttaatcactatagaagtcatcacaatttaatccatggtttaaaa
ccccacttcaaactctttcgcccatccagtgagtctgagcaaggactcactagacctaat
gctgataccgggtccatccgcagtttacagacaggtgtgggagagttgcatggggaaacc
agattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaacttgat
aaaccttttgctgatttcattgacaggtactccatgccccggatgccctggcatgacatt
gcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatccagcgctgg
aacttcacgaaaattatgaaatcaaaatatcggtccctttcttatccttttctgcttcca
aagtctcaaacaacagcccatgagctgagatatcaagtacctgggtctgtccatgctaac
gtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagagtcc
atccatgccgcttacgtccatgtgatagagaacagcaggcactatatctatatcgaaaac
cagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgccatt
gcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtgata
ccgcttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacaggca
atcatgcacttcaactacagaaccatgtgcagaggagaaaattccattcttggacagtta
aaagcagagcttggcaatcagtggataaattacatatcattctgtggtcttagaacacat
gcagagctggaaggaaacctagtcaccgagcttatctatgtccacagcaagttgttaatt
gctgatgataacactgttattattggctctgccaacataaacgaccggagtatgctggga
aagcgtgacagtgaaatggctgtcattgtgcaagatacagaaactgttccttcagtaatg
gatggagaagagtaccaagctggccggtttgcccaaggacttcggctacagtgctttagg
gtcgtccttggctatcttgatgacccaagtgaggacattcaggatccagtgagtgacaaa
ttcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgacaaggtg
tttcggtgccttcccaatgatgacgtacacaatttaattcagctgagagactttataaac
aagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaagaagatccgt
ggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttctgtt
ggaaccaaagaggccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system