KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663117
Entry
104663117         CDS       T03989                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04072  Phospholipase D signaling pathway
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104663117 (RALA)
   04015 Rap1 signaling pathway
    104663117 (RALA)
   04072 Phospholipase D signaling pathway
    104663117 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663117 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104663117 (RALA)
   05212 Pancreatic cancer
    104663117 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104663117 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104663117 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104663117 (RALA)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    104663117 (RALA)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    104663117 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF
Other DBs
NCBI-GeneID: 104663117
NCBI-ProteinID: XP_010362552
UniProt: A0A2K6QPD4
LinkDB
Position
6
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgcaaataagcccaagggtcagaattctttggccttacacaaagtcatcatggta
ggcagtggtggcgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctagatggggag
gaagtacagatcgatatcttagatacagctgggcaggaggactacgctgcaattagagac
aactacttccgaagcggggaggggttcctctgtgttttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccctttctactggttggtaacaaatcagatttagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgagcagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagaaattcgagcaagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672611
Entry
104672611         CDS       T03989                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04072  Phospholipase D signaling pathway
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104672611 (RALB)
   04015 Rap1 signaling pathway
    104672611 (RALB)
   04072 Phospholipase D signaling pathway
    104672611 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672611 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104672611 (RALB)
   05212 Pancreatic cancer
    104672611 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104672611 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104672611 (RALB)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    104672611 (RALB)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    104672611 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N AAA_24 Ser_hydrolase
Other DBs
NCBI-GeneID: 104672611
NCBI-ProteinID: XP_010374736
UniProt: A0A2K6NHU2
LinkDB
Position
14
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSGKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagtggaggcgttggcaagtcggccctgacgcttcagttcatgtatgacgagtttgta
gaagactacgagcctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcc
tttacagcaactgccgaattcagggagcagattctccgtgtgaaggctgaagaagataaa
attccattgcttgtcgtgggaaacaagtctgacttagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggggcgtgcagtacgtggagacatcggcgaag
acgcgggccaatgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcggcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

DBGET integrated database retrieval system